|
|
Pygmy Slow Loris - Nycticebus pygmaeusIUCN Status: VulnerableIUCN Species Profile http://www.szgdocent.org/pp/p-loris2.htm More about the LORIS SPECIES: LINKS to more lorises ... Duke Primate Centre fact sheets, photos, distribution map on Slow Loris, Pygmy Slow Loris, Slender loris. ... http://www.szgdocent.org/pp/p-loris.htm LORISES and POTTOS: LINKS to more lorises and pottos ... Duke Primate Centre fact sheets, photos, distribution map on Slow loris, Pygmy slow loris, Slender loris. ... http://www.mnzoo.com/animals/tropics_trail/ploris_1.asp Minnesota Zoo/Animals/Tropics Trail/Pygmy Loris: Animal Search AZ. Pygmy Slow Loris. ... http://www.mnzoo.com/animals/tropics_trail/ploris_2.asp Minnesota Zoo/Animals/Tropics Trail/Pygmy Loris: ...pygmaeus. Animal Search AZ. PYGMY SLOW LORIS CONTINUED. Range and Habitat: Laos, Vietnam and Cambodia. They are nocturnal and arboreal. ... http://www.quantum-conservation.org/EEP/PYGMY%20SLOW%20LORIS.html PYGMY SLOW LORIS: PYGMY SLOW LORIS. PYGMY SLOW LORIS NYCTICEBUS PYGMAEUS Mr. Radoslaw Ratajszczak Poznan Zoo ul. Browarna 25 61-063 Poznan Poland Mr. Radoslaw Ratajszczak, http://www.quantum-conservation.org/EEP/EEP2004.html European Endangered Species Programm (EEP): BLACK LEMUR, SCLATER'S LEMUR, MONGOOSE LEMUR. ALAOTRAN GENTLE LEMUR, RUFFED LEMURS, SLENDER LORIS. PYGMY SLOW LORIS, RED TITI, BLACK_CAPPED SQUIRREL MONKEY. ... http://collections.ic.gc.ca/crystalgarden/today_biology_detail.asp?ID=44 Crystal Gardens: Pygmy Slow Loris. Nycticebus pygmaea. EXTINCTION DANGER LEVEL 4 FAMILY. Lorisidae. LOCATION. Vietnam, Laos & Cambodia. HABITAT. Secondary Forests. ... http://collections.ic.gc.ca/crystalgarden/today_biology_mammals.asp Crystal Gardens: Eulemur mongoz, Pygmy Marmoset, Pygmy Marmoset Callithrix pygmaea, Pygmy Slow Loris, Pygmy Slow Loris Nycticebus pygmaea, Ring-Tailed ... http://www.kingsnake.com/toxinology/loris/slow_loris.html Slow Loris Research: There are two species of loris described. The pygmy slow loris (Nycticebus pygmaeus) and the slow loris (Nycticebus coucang). The ... http://www.torbytes.co.uk/op/tm5/lv2/item1247.htm Pygmy Slow Loris feed record: Pygmy Slow Loris. Food, Mon, Tue, Wed, Thur, Fri, Sat, Sun. Chick legs, 10, 0, 0, 0, 10, 0, 0. Fruit and Dried Fruit grms, 0, 65, 0, 0, 0, 65, 0. Fruit and Boiled Egg, 0, 0, 0, 65, 0, 0, 65. ... http://www.torbytes.co.uk/op/tm5/lv2/item1264-def.htm t5x56x1264.jpg: ...[Pygmy Slow Loris]. [Pygmy Slow Loris] A Pygmy Slow Loris peers through the night of the Nocturnal House. © copyright Paignton Zoo. ... http://www.sfcelticmusic.com/js/LEMURS/lorises.htm Lorises, Pottos, Galagos (Bush Babies) & Tarsiers: Perodictus potto, Potto (7); Nycticebus coucang, Slow loris (16); Nycticebus pygmaeus, Pygmy slow loris (10); ... Pygmy Slow Loris (Nycticebus pygmaeus). ... http://www.sfcelticmusic.com/js/LEMURS/locallem.htm Local Lemurs & Lorises (USA): Lorises, galagos (bushbabies), and potto. Perodictus potto, Potto (7); Nycticebus coucang, Slow loris (16); Nycticebus pygmaeus, Pygmy slow loris (10); ... http://animaldiversity.ummz.umich.edu/site/accounts/information/Nycticebus_pygmaeus.html ADW: Nycticebus pygmaeus: Information: Nycticebus pygmaeus (pygmy slow loris). ... This animal weighs approximately 1 kg (2 lbs). The wooly coat of the pygmy slow loris is short and thick. ... http://animaldiversity.ummz.umich.edu/site/accounts/classification/Nycticebus_pygmaeus.html ADW: Nycticebus pygmaeus: Classification: Nycticebus pygmaeus (pygmy slow loris). Information; Classification. What do these icons mean? The icons tell you what features are available for that taxon. ... http://www.damisela.com/zoo/mam/primates/loridae/nombres.htm Loris: ...- [ Translate this page ] ... Lori Esbelto, Slender Loris, Loris tardigradus. Lori Perezoso, Slow Loris, Nycticebus coucang. Lori Perezoso Pigmeo, Pygmy Slow Loris, Nycticebus pygmaeus. ... http://www.damisela.com/zoo/mam/primates/loridae/pygmaeus/ Lori Perezoso Pigmeo: ...- [ Translate this page ] ... El peso es de unos 370 a 500 gramos. Al Lori Perezoso Pigmeo también se le llama Lori Perezoso Enano. En inglés se le conoce por Pygmy Slow Loris. ... http://www.primatestore.com/taxonomycommon.htm Primate Taxonomy Common -> Primate Scientific Names: ...chrysomelas. Loris. Pygmy slow loris - Nycticebus pygmaeus Slender loris - Loris tardigradus Slow loris - Nycticebus coucang. Macaque. ... http://www.primatestore.com/taxonomyscientific.htm Primate Taxonomy Scientific -> Primate Common Names: Necrolemur. Necrolemur antiquus Necrolemur zitteli. Nycticebus - Slow loris. Nycticebus coucang - Slow loris Nycticebus pygameus - Pygmy slow loris. Otolemur. ... http://www.ipbir.org/ipbir_cgi/tax.cgi?mode=2&id=14&lvl=2 IPBIR: Integrated Primate Biomaterials and Information Resource ...: Male, born in captivity. PR01018, Nycticebus pygmaeus, pygmy slow loris, Tissue Skin, 2 YR, Male, born in captivity. The IPBIR taxonomy database ... http://www.ipbir.org/ipbir_cgi/tax.cgi?mode=2&id=3&lvl=1 IPBIR: Integrated Primate Biomaterials and Information Resource ...: ...born in captivity. PR01018, Nycticebus pygmaeus, pygmy slow loris, Tissue Skin, 2 YR, Male, born in captivity. PR00048, Otolemur garnettii, ... http://www.snowcrest.net/goehring/a2/primates/loris.htm <h2>Loris</h2>: The common names for the species above respective in order (except for the aureus) are: "golden potto", "slender loris", "pygmy slow loris", and "potto". ... http://www.sos-magots.com/autresinges.htm Liste des primâtes: 1.00. Nycticebus coucang, Slow, Common slow loris, 0.68. 0.63. 1.08. Nycticebus pygmaeus, Pygmy slow loris, 0.46. 0.38. 1.23. Perodictus potto, Potto, Potto gibbon, 0.83. ... http://home.globalcrossing.net/~brendel/primate.html PRIMATES (prosimians, monkeys, apes and humans): Genus Nycticebus. Nycticebus coucang (slow loris) Nycticebus pygmaeus (pygmy slow loris, pigmy loris). Genus Perodicticus. Perodicticus potto (potto gibbon). ... http://www.clemetzoo.com/pressroom/index.asp?action=details&prelease_id=1008&strQuery=&intNext=1 The Cleveland Metroparks Zoo: Cat & Aquatics Building: Western lowland gorilla Chimpanzee Golden-bellied mangabey Francois' langur Slow loris Slender loris Pygmy slow loris Potto Hamadryus ... http://staff.washington.edu/timk/wildlife/text/facts.html Wildlife Web: Animal Facts: Animal Facts This section of the Wildlife Web features information and facts on a wide variety of species. Animal Bytes: Animal Bytes ... http://csp.medic.kumamoto-u.ac.jp/CSP/CXCR/CXCR4-cDNA.html CXCR4-cDNA: AF172206, Nycticebus intermedius CXCR4, 93 bp. AF172207, pygmy slow loris CXCR4, 93 bp. ... AF172241, pygmy slow loris CXCR4, 1041 bp. AF172242, black lemur CXCR4, 1044 bp. ... http://csp.medic.kumamoto-u.ac.jp/CSP/CXCR/CXCR4-Protein.html CXCR4-Protein: ...potto CXCR4, (Q9MZM0). black lemur CXCR4, (Q9MZM1). pygmy slow loris CXCR4, (Q9MZM2). Nycticebus intermedius CXCR4, (Q9MZM3). slow loris CXCR4, (Q9MZM4). ... http://www.amazonworld.co.uk/mammals.html Mammals at Amazon World Zoo Park: We house both our Slow Loris and Pygmy Slow Loris in 'Reverse lighting enclosures' this means that their night time is actually our day time! ... http://www.extinctanimal.com/endangered/endangered_mammals.htm Endangered Mammals: Arena mountain beaver; Pronghorn, Sonoran; Przewalski's horse; Puma; Pygmy hippopotamus; Pygmy rabbit; Pygmy slow loris; Red panda bear; ... http://content.karger.com/ProdukteDB/produkte.asp?Aktion=ShowFulltext&ProduktNr=223842&Ausgabe=227680&ArtikelNr=49918 Karger Publishers: ...marked lemurs (Phaner furcifer) [5, 6]. We present the first evidence of tree-gouging and exudate-eating behavior in the pygmy slow loris (Nycticebus pygmaeus ... http://www.phthiraptera.org/Mammals/Loridae.html Mammals: Loridae: Nycticebus coucang (Boddaert, 1785). - Slow Loris Felicola mjoebergi (Stobbe, 1913) *. Nycticebus pygmaeus Bonhote, 1907 - Pygmy Slow Loris. ... http://warprc.org/psic/taxonomy.asp PSIC-Taxonomy: Nycticebus :Slow lorises. Nycticebus coucang, Slow loris. Nycticebus pygmaeus, Pygmy slow loris. * Perodicticus :Potto. Perodicticus potto, Potto. ... http://www.species.net/Primates/loris/ Table 2 b: Np Ib, N. pygmaeus (Bonhote, 1907) 4 , distinguished from N. intermedius). Lesser slow loris 12 , pygmy slow loris 1, Zwergplumploris, Kleiner Plumplori 12, ... http://etologia1.psi.ub.es/etopri/tlori.htm tlori: Angwantibo. Loris, tardigradus, Slender loris. Nycticebus, coucang, Common slow loris. Nycticebus, pygmaeus, Pygmy slow loris. Taxonomia. ? http://www.itis.usda.gov/servlet/SingleRpt/SingleRpt?search_topic=TSN&search_value=572799 ITIS Standard Report Page: Nycticebus: Direct Children: Species, Nycticebus coucang (Boddaert, 1785) -- slow Loris, Species, Nycticebus pygmaeus Bonhote, 1907 -- pygmy slow Loris, References, Expert(s): ... http://www.itis.usda.gov/servlet/SingleRpt/RefRpt?search_type=expert&search_id=expert_id&search_id_value=40 ITIS 'Expert(s)' Search results for Colin P. Groves: Loris. Nycticebus pygmaeus Bonhote, 1907 -- valid -- pygmy slow Loris. Onychogalea Gray, 1841 -- valid -- nail-tailed wallabies. Onychogalea ... http://www.aza.org/SiteIndex/WhatsNew/ American Zoo and Aquarium Association: Callimico Husbandry Manual April 29, 2004. Inca Tern PMP and MateRx Matrix April 28, 2004. Pygmy Slow Loris and Slender Loris Studbook April 27, 2004. ... http://www.brookfieldzoo.org/pagegen/generate.asp?pageid=260 Conservation Breeding: ...humboldti); Lesser (Pygmy) Slow Loris (Nycticebus pygmaeus); Mandrill (Papio sphinx); Matschie's Tree Kangaroo (Dendrolagus matschiei); ... http://www.savecrystalgarden.com/TC-lavoie-jan23.htm SAVE Crystal Garden: CREDIT: Deddeda Stemler, Times Colonist A pygmy slow loris, native to southeast Asia and weighing about 600 grams, is among the exotic species that have been ... http://www.lazoo.org/societypop2aform.html Welcome to the LA Zoo: Central Chinese Goral Tadjik Markhor Crested capuchin Red-crowned mangabey Kikuyu Colubus monkey Female mandrill Island fox Pygmy slow loris Coquerel's Sifaka ... http://veederandld.20m.com/primates.html Primate Links: Slow Loris Factsheet; Duke University Slow Loris Factsheet; Pygmy Loris Factsheet; Duke University Pygmy Slow Loris Factsheet; Duke ... http://www.iun.edu/~anthronw/news3-22-03.txt Subject: booksale, etc 2 Date: Sat, 22 Mar 2003 17:38:09 -0600 ...: ...a href="http://www.henrydoorlyzoo.org">http://www.henrydoorlyzoo.org</a> White handed Gibbons Pygmy slow loris Francious Langurs Ring-Tailed lemurs Ruffed ... http://mrspainter.com/mammalslq.htm Mammals LQ for Junior High School Reports: Pygmy Slow Loris (Ory P./Ms. Dubble/5) http://animaldiversity.ummz.umich.edu/accounts /nycticebus/n._pygmaeus$narrative.html#geographic_range http://www.duke ... http://www.allpictures.biz/Baby/Baby.htm BABY PICTURES - The Best Baby Pictures!: Pictures Of Baby Jesus; Pictures Of Baby Koalas; Pictures Of Baby Puppies; Pictures Of Baby Pygmy Slow Loris; Pictures Of Baby Rooms; ... http://www.zoo.ch/index.php?id=831&uid=266 Zoo Zürich - detail1: ...- [ Translate this page ]###navigation###. Nycticebus pygmaeus Zwergplumplori Petit Loris paresseux Nitticebo pigmeo Pygmy Slow Loris Steckbrief. Ausdruckbare ... http://www.adventureswithandrea.com/thailand-markets.htm Adventures with Andrea: The first picture is (I believe) a "Pygmy Slow Loris." I don't know whether this species is endangered or if it is legal to trade but there it was for sale. ... http://www.smarttechtoys.com/toys/baby/pictures-of-baby-pygmy-slow-loris.asp www.smarttechtoys.com/toys/baby/pictures-of-baby-pygmy-slow-loris.asp: Similar pages Smarttechtoys Baby ... baby jesus pictures of baby koalas pictures of baby lamb pictures of baby looney tunes pictures of baby puppies pictures of baby pygmy slow loris pictures of ... http://www.smarttechtoys.com/toys/baby/baby-42.asp Report Start Detailed Inventory Report for Mammalia Report End ...: Nycticebus pygmaeus Vulnerable App. II PYGMY SLOW LORIS Owned and . . . . . On-site In on Loan . . . . ... http://www.freelists.org/archives/lano666/06-2003/msg00491.html FreeLists / lano666 / Il Loris: Suborder: Prosimii Superfamily: Lorisoidea Family: Lorisidae Genus: Nycticebus Species: coucang Related Species: The Pygmy slow loris (Nycticebus pygmaeus) and ... http://www.nap.edu/books/0309069890/html/266.html Nat'l Academies Press, Nutrient Requirements of Nonhuman Primates ...: Loris tardigradus. Slender loris. Nycticebus coucang. Slow loris. Nycticebus pygmaeus. Pygmy slow loris. Perodicticus potto. Potto. Family Galagonidae. Euoticus spp. ... http://www.gpcr.org/7tm/seq/all/Q9MZM2.SW.html Swiss-Prot entry: TrEMBLrel. 26, Last annotation update) DE Chemokine receptor CXCR4 (Fragment). GN CXCR4. OS Nycticebus pygmaeus (Pygmy slow loris). OC ... http://www.gpcr.org/7tm/seq/DRlist.html GPCRDB Database Cross-references: Q9DGI1 CXCR4 (chicken); Q9MZM0 CXCR4 (potto); Q9MZM1 CXCR4 (petterus macaco); Q9MZM2 CXCR4 (pygmy slow loris); Q9MZM3 CXCR4 (nycticebus ... http://savci.upol.cz/primati.htm Primates - Primáti: ...lori váhavý) - Slow Loris Nycticebus pygmaeus Bonhote, 1907 - outloň malý - Pygmy Slow Loris. Perodicticus potto (Müller, 1766) - poto velký (syn. ... http://cybersleuth-kids.com/sleuth/Science/Animals/Mammals/Primates/Lemurs/index1.htm Lemurs: ...mongoose.html; Potto http: //duke.edu/web/primate/potto.html; Pygmy slow loris http: //duke.edu/web/primate/pygmylor.html; Red Ruffed ... http://www1.soeinet.or.jp/~safvet/Data/IZY32.html C:\WINDOWS\ﾃﾞｽｸﾄｯﾌﾟ\MyDataHTML\Izy\Izy32.html: 221Hand-rearing and reintroduction of a pygmy slow loris (Nycticebus pygmaeus) at Brookfield Zoo, Chicago. Brookfield ... http://www.cincyzoo.org/Education/PublicPrograms/childrens%20programs/childrensprograms.html ..:: Welcome To The Cincinnati Zoo ::..: Encourage the wildlife enthusiast in your child through a Cincinnati Zoo and Botanical Garden Zoo class. photo: Pygmy slow loris. ... http://www.primate.wisc.edu/pin/Common.html Common Names for the Order Primates: Nycticebus pygameus. English: Lesser Slow Loris. Pygmy Slow Loris. German: Kleiner Plumpori. Otolemur crassicaudatus. English: Thick-Tailed Bushbaby. Greater Galago. ... http://www.primate.wisc.edu/pin/idp/idptags.html International Directory of Primatology: Taxon Advisory Groups ...: Nycticebus pygmaeus (Pygmy Slow Loris) EEP (European & United Kingdom) Species Program Radoslav Ratajszczak Wielkopolski Park Zoologiczny, Poznan, Poland 48-61 ... http://www.cs.ubc.ca/~jslack/tj/mammalia_A_03-04-16.nh (((((('platypus')'ornithorhynchus')'ornithorhynchidae' ...: ...varecia')'lemuridae',(('golden angwantibo','calabar angwantibo')'arctocebus',('slender loris')'loris',('slow loris','pygmy slow loris')'nycticebus',('potto ... http://www.cs.ubc.ca/~jslack/tj/mammalia_B_03-04-16.nh ((((('pronghorn')'pronghorn')'bovids',((('impala')'aepyceros')' ...: ...golden angwantibo','calabar angwantibo')'angwantibos or golden pottos',('slender loris')'slender lorises',('slow loris','pygmy slow loris')'slow lorises ... http://www.calgaryzoo.org/HelpingTheZoo/Donations/other_animals_etc.htm other_animals_etc: Colobus Monkey. Przewalski's Wild Horse. Vancouver Island Marmot. Cotton-Top Tamarin. Pygmy Slow Loris. Warthog. Cougar. Red Panda. Western Grey Kangaroo. ... http://members.tripod.com/cacajao/nycticebus_links.html Nycticebus Links: Nycticebus pygmaeus (Lesser Slow Loris) Crystal Gardens: Nycticebus pygmaeus (Lesser Slow Loris) Damisela: Nycticebus pygmaeus (Pygmy Slow Loris) (in Spanish ... http://www.absoluteasia.com/lao/people.asp Luxury travel to Laos - Laos tours - Asia travel - ABSOLUTE ASIA ...: ...trees, and hardwoods. Endemic species include pangolin, lesser panda, pygmy slow loris, and the snub-nosed langur. There are over ... http://www.impeyan.co.uk/aboutimpeyan.htm About Impeyan: Some of the Toucans are now on breeding loan at London and Whipsnade Zoos. Other successes have included 'The Pygmy Slow Loris' from Vietnam. ... http://www.infobiogen.fr/db/index-lassap/SPTR_25/mam.seq Q9N1N1 #AC Q9N1N1; #OS PAPIO HAMADRYAS (HAMADRYAS BABOON). #DE ...: DE BRCA1 HOMOLOGUE (FRAGMENT). #KW CSKDTRNGTEGFKYPLGPEVNYSQETSIDMEESELDTQYLQ >Q9MZM2 #AC Q9MZM2; #OS NYCTICEBUS PYGMAEUS (PYGMY SLOW LORIS). ... http://www.chinjuh.mydns.jp/sengai/vortaro/simio_c.htm Smioj en la china lingvo: ...å’Œå??, ピグミースãƒãƒ¼ãƒãƒªã‚¹. å¸å??, Nycticebus pygmaeus. 英å??, Pygmy Slow Loris. ä¸å??, ?長懶猴. å’Œå??, スレンダー ãƒãƒªã‚¹. ... http://www.chinjuh.mydns.jp/sengai/vortaro/simio_t.htm Smioj en la china lingvo: ...å’Œå??, ピグミースãƒãƒ¼ãƒãƒªã‚¹. å¸å??, Nycticebus pygmaeus. 英 å??, Pygmy Slow Loris. ä¸å??, &T21CD77;長懶猴. å’Œå??, スレンダー ãƒãƒªã‚¹. ... http://www.zoonews.ws/IZN/305/IZN-305.html International Zoo News Vol. 47/8 (No. 305): Pygmy slow loris and Asian horned beetle. ... Our pygmy slow loris (Nycticebus pygmaeus) exhibit is about 4.6 square metres in area and 2.3 metres high. ... http://www.zoonews.ws/IZN/322/IZN-322.htm International Zoo News Vol. 50/1 (No. 312) January/February 2003: Red-handed tamarin (Saguinus midas);. Cotton-top tamarin (Saguinus oedipus);. Pygmy slow loris (Nycticebus pygmaeus). Enrichment methods. ... Pygmy slow loris. ... http://scotter.ca/zoophotos.html Scotter's Calgary Zoo Photos: Primates Ring-tailed Lemur; Red-Ruffed Lemur; Pygmy Slow Loris; Cottontop Tamarin; Japanese Macaque; Squirrel Monkey; Spider Monkey; Black ... http://www.photographersdirect.com/sellers/requests.asp?oldcount=100 Photographers Direct - Fair Trade Photography - stock images ...: ...horse (Equus przewalskii) Purple-naped lory (Lorius domicellus) Pygmy hippopotamus (Hexaprotodon [Choeropsis] liberiensis) Pygmy slow loris (Nycticebus pygmaeus ... http://genome.jouy.inra.fr/db/gcg/embl/em_om_000.seq Q9N1N1 6/2003 ASCII Len: 159 Q9n1n1 papio hamadryas (hamadryas ...: ...brca1 homologue (fragment). 10/2000 CSKDTRNGTEGFKYPLGPEVNYSQETSIDMEESELDTQYLQ >>>>Q9MZM2 3/2004 ASCII Len: 346 Q9mzm2 nycticebus pygmaeus (pygmy slow loris). ... http://www.psgb.org/Meetings/Spring2003.html PSGB Sprint Meeting 2003: ...the IUCN 2002 presently classifies the conservation status of slow loris (Nycticebus coucang) as data deficient, the pygmy slow loris (Nycticebus pygmaeus) as ... http://www.visualsunlimited.com/browse/vu210/dirpage.html Visuals Unlimited Stock Photography: ...vu210591 - Human scalp, hair bulb; vu210592 - Ruby, 1387 carats; vu210593 - Lesser, Pygmy, Slow Loris (Nycticebus caucang pygmaeus); ... http://www.visualsunlimited.com/browse/vu213/dirpage.html Visuals Unlimited Stock Photography: ...vu213731 - Ruffed Lemur (Varecia variegata) Eastern Madagascar; vu213732 - Lesser (Pygmy) Slow Loris (Nycticebus caucang pygmaeus) Forests of Indonesia and ... http://uts.cc.utexas.edu/~bramblet/ant301/eight.html Primates as an Adaptive Array: 1000g. There is also a diminutive form of the slow loris, the pygmy slow loris (Nycticebus pygmaeus) with a body weight of 300g. ... http://www.screensavers--portal.com/sitemap-20.php Starfish Pictures: ...backgrounds judge pictures karate kid pictures middle age pictures nokia 3650 screensaver pictures of Luxembourg pictures of baby pygmy slow loris pictures of ... http://www.screensavers--portal.com/pictures-of-baby-pygmy-slow-loris.php www.screensavers--portal.com/pictures-of-baby-pygmy-slow-loris.php: Similar pages [PDF] Asian Primate ClassificationFile Format: PDF/Adobe Acrobat - View as HTML ... Pygmy slow loris N. pygmaeus Bonhote, 1907 (A) E. Cambodia, S. China, Laos, Vietnam VU A1cd Nycticebus pygmaeus includes N. intermedius Dao, 1960 (from Hoa Binh ... http://www.baby-dir-online.com/sitemap-7.php [an error occurred while processing this directive] Pygmy Slow Loris [an error occurred while processing this directive] 14941 Nycticebus pygmaeus Nycticebus pygmaeus |