|
|
Allactaga elater - Small Five-Toed JerboaIUCN Status: Lower Risk/Least ConcernIUCN Species Profile http://animaldiversity.ummz.umich.edu/site/accounts/specimens/Allactaga_elater.html ADW: Allactaga elater: Classification: ...elater. Allactaga elater (small five-toed jerboa). ... elater. small five-toed jerboa Allactaga elater, small five-toed jerboa Allactaga elater. ... http://www.itis.usda.gov/servlet/SingleRpt/SingleRpt?search_topic=TSN&search_value=609735 ITIS Standard Report Page: Allactaga elater: Go to Print Version, Allactaga elater (Lichtenstein, 1828) Taxonomic Serial No.: 609735. ... Species, Allactaga elater (Lichtenstein, 1828), References, Expert(s): ... http://www.itis.usda.gov/servlet/SingleRpt/RefRpt?search_type=publication&search_id=pub_id&search_id_value=1422 ITIS 'Publication' Search results for Wilson, Don E., and DeeAnn M ...: Allactaga bullata Allen, 1925 -- valid. Allactaga elater (Lichtenstein, 1828) -- valid. Allactaga euphratica Thomas, 1881 -- valid. ... http://www.funet.fi/pub/sci/bio/life/mammalia/rodentia/dipodidae/allactaga/ Allactaga: Allactaga elater (Lichtenstein, 1825) Small Five-toed Jerboa Dipus elater Lichtenstein, 1825; (E. Kazakhstan) dzungariae; (Zungaria) vinogradovi elater indica ... http://www.funet.fi/pub/sci/bio/life/warp/mammals-index-k.html All (in this database) Mammals list (Scientific names): Vulpes vulpes; kizljaricus (Allactaga elater), see Allactaga elater; kjusjurensis (Microtus), see Microtus oeconomus; klossi (Rhinolophus ... http://www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=mitochondrion+Allactaga+elater+%5Bgbrod%5D Codon usage table: ...mitochondrion Allactaga elater [gbrod]: 1 CDS's (380 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU 10.5( 4) UCU ... http://www.kazusa.or.jp/codon/Mitochondrion.html Alphabetical list: Mitochondrion: ...fuelleborni [gbvrt]: 3 mitochondrion Alethe poliocephala [gbvrt]: 12 mitochondrion Alethe poliophrys [gbvrt]: 3 mitochondrion Allactaga elater [gbrod]: 1 ... http://www.biodiversity.ru/programs/rodent/species/allactaga_elater.html ЦОДП - Грызуны бывшего СССР- Виды ...: К.Ð?. Роговин. Малый тушканчик. Allactaga elater (Lichtenstein, 1825). ... Подвиды: Allactaga elater elater (Lichtenstein, 1825) (syn. ... http://www.biodiversity.ru/programs/rodent/distribution/allactaga_elater/map.html ЦОДП - Грызуны бывшего СССР- Виды ...: Малый тушканчик. Allactaga elater (Lichtenstein, 1825). РаÑ?проÑ?транение (Ð?вторы: Шенброт Г.И.). ... http://szmn.sbras.ru/Gallery/mammals/Allactaga_elater.htm Allactaga elater, color photos: Малый тушканчик - Allactaga elater (Lichtenstein, 1825). Фото Ю.К.Зинченко. КазахÑ?тан, ЗайÑ?анÑ?каÑ? ... http://szmn.sbras.ru/Gallery/mammals/mammalia.htm Mammalia: Ñ?емейÑ?тво ЛОЖÐ?ОТУШКÐ?Ð?ЧИКОВЫЕ - Allactagidae Тушканчик малый - Allactaga elater (Lichtenstein, 1825) цветное ... http://www.fact-index.com/j/je/jerboa.html Jerboa: Subfamily Allactaginae: Balikun Jerboa, Allactaga balikunica; Gobi Jerboa, Allactaga bullata; Small Five-toed Jerboa, Allactaga elater; ... http://www.zooclub.ru/mouse/tushk/6.shtml Малый тушканчик (Allactaga elater) ...: Малый тушканчик (Allactaga elater). МногочиÑ?ленный вид грызунов. Длина тела до 13 Ñ?м. ... http://www.zooclub.ru/mouse/tushk/index.shtml Тушканчики, попрыгунчики, Ñ?елевиниÑ? ...: Advertising Network, ... http://www.interaktv.com/mammals/Rodentia2myo.html Biologybase: Mammals of the World: Rodentia 2 (Myomorpha): Perognathus xanthanotus. Dipodidae, Allactaginae, Allactaga balikunica. Allactaga bullata. Allactaga elater. Allactaga euphratica. Allactaga firouzi. Allactaga hotsoni. ... http://szmn.eco.nsc.ru/Vertebr/Mamcol/Rodentia/Allactaga_elater.htm Allactaga elater: Allactaga elater (Lichtenstein, 1825). photo Yu.K.Zintshenko. Kazakhstan, East Kazakhstan province, Lake Zaisan, 1997. КазахÑ?тан ... http://www.apus.ru/site.xp/052056051124050055053055124.html APUS.RU | Тушканчик малый: Малый тушканчик - Allactaga elater - ближайший Ñ?ородич трехпалого карликового тушканчика ... http://www.apus.ru/site.xp/049053057124-a.html APUS.RU | Словарь Филина: Gray JE - Кеклик; Allactaga elater - Тушканчик малый; Alle alle Linnaeus - Люрик; Alligater sinensis - Ð?ллигатор ... http://azerimammals.aznet.org/azerimammals/Rodets.htm RODENTIA: ...with 2 species of 2 genera - Glis glis ( Fat dormouse) and Dryomys nitedula (Forest dormouse); 5. Dipodidae with 2 species - Allactaga elater (Small five-toed ... http://azerimammals.aznet.org/azerimammals/Rodets_Rus.htm RODENTIA: первую очередь, Microtus socialis (общеÑ?твеннаÑ? или Ñ?тепнаÑ? полевка), Allactaga elater ( малый тушканчик ... http://www.arcbc.org/cgi-bin/abiss.exe/ld?ld=sp_list.htm&tx=MA Species List: Dipodidae Allactaga balikunica, Dipodidae Allactaga bullata, Dipodidae Allactaga elater, Dipodidae Allactaga euphratica, Dipodidae Allactaga firouzi, ... http://www.geocities.com/mammalia_2000/ROD.htm TÃœRKÄ°YE RODENTIA TÃœRLERÄ°: Genus: Allactaga F.Cuvier, 1837 (= AraptavÅŸanları): Allactaga elater (Lichtenstein, 1828) (BeÅŸparmaklı AraptavÅŸanı = Küçük BeÅŸparmaklı AraptavÅŸanı ... http://www.geocities.com/Athens/Cyprus/4397/szmn/Vertebr/Allactag.htm Allactagidae collection of SZMN, Novosibirsk, Russia: ...skin. Kupinskyi district, Lyagushachje village, 1949 - 2 skins. Allactaga elater (Lichtenstein, 1825) - 7 specimens. TADJIKISTAN ... http://www.biltek.tubitak.gov.tr/canlilar/TR_tur_listesi/liste_memeli.htm .:Bilim ve Teknik Web Sitesi::Türkiye Tür Listeleri::Memeliler:.: Allactaga euphratica Thomas, 1881 (AraptavÅŸanı) Allactaga elater (Lichtensteini, 1825) (AraptavÅŸanı) Allactaga williamsi Thomas, 1897 (AraptavÅŸanı ... http://133.87.224.209/lecture/2001/ech2001shai.html SHAIKENOV: ...were found in 18 species: Marmota baibacina (2.24-8%), M. bobac (3.1-6.4), Citellus pygmaeus (0.5), Allactagulus acantion (1 case), Allactaga elater (0.4-1.2 ... http://www.phthiraptera.org/Mammals/Dipodidae.html Mammals: Dipodidae: Allactaga elater (Lichtenstein, 1828) - Small Five-toed Jerboa Eulinognathus aculeatus (Neumann, 1912). Eulinognathus elateri Chirov and Ozerova, 1990 *. ... http://perso.club-internet.fr/boudetjo/ZooList/Mammif/ClasRode.html Classification des Rodentiens: DIPODIDAE, ALLACTAGINAE, Allactaga Allactodipus Pygeretmus, Allactaga balikunica Allactaga bullata Allactaga elater Allactaga euphratica Allactaga firouzi ... http://www.nacres.org/cons_bo5.html Mammals: ...- ... Armenian Red Date Book. Azerbaijanian Red Date Book. Georgian Red Date Book. Allactaga elater. Allactaga willamsi. Apodemus fulvipectus, Apodemus ponticus. ... http://www.ubio.org/SOAPbrowser/index.php?func=list_by_package&pkg_id=4 TNS Browser: Allactaga balikunica Hsia and Fang, 1964. Allactaga bullata Allen, 1925. Allactaga elater (Lichtenstein, 1828). Allactaga euphratica Thomas, 1881. ... http://www.chinabiodiversity.com/search/english/locate.shtm?id=65&layer=1 ¶¯ÎïËÑË÷: ...undulatus |Tamias¡¡sibiricus |Pteromys¡¡volans |Castor¡¡fiber |Allactaga¡¡balikunica |Allactaga¡¡bullata |Allactaga¡¡elater |Allactaga¡¡major ... http://www.chinabiodiversity.com/search/detail.shtm?cspcode=011410003 ç”Ÿç‰©å¤šæ ·æ€§: ...ä¸æ–‡å??: å°?äº”è¶¾è·³é¼ , 拉ä¸?æ–‡å??: Allactaga elater, 在Google上æ?œç´¢ æ¤ç‰©ç§?图片. 物ç§?鉴定特å¾?. 分类信æ?¯. æ¿’å?±ä¿¡æ?¯. 分布图. 分 布信æ?¯. ... http://www.lirmm.fr/~vberry/COURS/IRD/PHYLO/2004/29-sequences ID ALIGN_000004; DNA; 1244 symbols (29 sequences) XX AC ...: AJ224663 Cavia porcellus SO 19 Trichys AJ224675 Trichys fasciculata SO 20 Coendou AJ224664 Coendou melanurus SO 21 Allactaga AJ224661 Allactaga elater SO 22 ... http://wikipedia.infostar.cz/j/je/jerboa.html Jerboa: Allactaginae: Balikun Jerboa, Allactaga balikunica; Gobi Jerboa, Allactaga bullata; Malý pÄ›t-poslouchaný Jerboa, Allactaga elater; ... http://www.grida.no/enrin/htmls/tadjik/soe2001/eng/htmls/biodiv/mammals.htm Tajikistan 2002. Biodiversity: Rare and endangered mammals: Citellus fulvus oxianus Thomas (1), Hystrix leucura satunini Muller (2), Allactaga severtzovi Vinogradov (1), Allactaga elater strandi Heptner (1), ... http://www.grida.no/enrin/htmls/tadjik/soe2001/rus/htmls/biodiv/mammals.htm ТаджикиÑ?тан 2002. Биоразнообразие ...: Тушканчик Северцова (1) Allactaga severtzovi Vinogradov, Малый тушканчик (1) Allactaga elater strandi Heptner, ... http://www.chez.com/rodent/Dipododae/Dipododae.html Dipododae: ...- ... doigts. (Siciste des bouleaux - Sicista betulina). Allactaga elater - Five-toed jerboa - Gerboise à cinq doigts. Antechinomys laniger ... http://www.savci.upol.cz/faq/checklist_eu.htm Savci.upol.cz - Checklist savcù Evropy - Checklist of European ...: ...- ... strandi (Formozov, 1931) Sicista subtilis (Pallas, 1773) Dipus sagitta (Pallas, 1773) Stylodipus telum (Lichtenstein, 1823) Allactaga elater (Lichtenstein, 1825 ... http://www.savci.upol.cz/hlod-1.htm Rodentia - Hlodavci: Allactaga balikunica Allen, 1925 - frÄ?ek mongolský - Gobi Jerboa Allactaga bullata Hsia & Fang, 1964 - frÄ?ek gobijský - Allactaga elater (Lichtenstein, 1828 ... http://www.emporia.edu/biosci/msl/rodent.htm MSL, Order Rodentia: ...(contributed by JF Eisenberg) Family DIPODIDAE - Jerboas. Allactaga elater - Five-toed jerboa - SW Asia; 80 Side view, Nat. Zool. Park, Washington, DC, USA. ... http://encyclopedia.thefreedictionary.com/Dipodidae Dipodidae - encyclopedia article about Dipodidae. Free access, no ...: Allactaginae; Balikun Jerboa, Allactaga balikunica; Gobi Jerboa, Allactaga bullata; Small Five-toed Jerboa, Allactaga elater; Euphrates ... http://www.angelfire.com/realm2/lex_exotics/sftjerboa.html Small Five-toed Jerboa: Small Five-toed Jerboa. Scientific name: Allactaga elater Size: 26-30cm long including tail Lifespan: 5-6 years Natural range: northern Africa to eastern Asia. ... http://www.blackwellpublishing.com/issue.asp?ref=0021-8782&vid=202&iid=4&oc=&s=&site=1 Journal of Anatomy Issue: View Abstract. 373-386 Immunocytochemical characteristics of elbow, knee and ankle muscles of the five-toed jerboa (Allactaga elater). ... http://www.nordiq.net/djurord/cgi-bin/sok.pl?bokstav=j&in=&ordlista=djurord&start=10&ord=J Sökresultat / Search Results - "J": Sv: jerboa (gnagare, Afrika & Asien) En: small five-toed jerboa/great jerboa Fr: petite gerboise/alactaga sauteur, gerboise La: Allactaga elater/major Sv ... http://www.european-mammals.org/felist.htm Mammal species in Europe: Stylodipus telum. (Lichtenstein, 1823). Thick-tailed three-toed jerboa. Allactaga elater. (Lichtenstein, 1828). Small five-toed jerboa. Allactaga major. (Kerr, 1792). ... http://www.iranica.com/articles/v9f4/v9f441b.html Iranica.com - FAUNA Cont.: ...sandy deserts Spermophilus leptodactylus), gerbils (Meriones lybicus and meridianus, Rhombomys opimus), and jerboas (Allactaga elater, psammophilous Allactaga ... http://pedant.gsf.de/cgi-bin/wwwfly.pl?Set=Candida_albicans_SC_5314&Alias=Candida_albicans_SC_5314&Page=taxrankspecies Candida_albicans_SC_5314: ...bairdii alexandrium fundyense alicyclobacillus acidocaldarius alicyclobacillus acidoterrestris alisma plantago-aquatica allactaga elater allagoptera arenaria ... http://pedant.gsf.de/cgi-bin/wwwfly.pl?Set=Drosophila_melanogaster&Alias=Drosophila_melanogaster&Page=taxrankspecies Drosophila_melanogaster: ...sh-69 alcanivorax borkumensis alcelaphine herpesvirus 1 alicyclobacillus acidocaldarius allactaga elater allenopithecus nigroviridis alligator mississippiensis ... http://eo.wikipedia.org/wiki/Ron%C4%9Duloj RonÄ?uloj - Vikipedio: ...genro : HELAMISO - Allactaga specio : helamiso granda - Allactaga major - frÄ?ek vÄ›tÅ¡Ã specio : helamiso malgranda - Allactaga elater - frÄ?ek menÅ¡Ã ... http://www.cs.ubc.ca/~jslack/tj/mammalia_A_03-04-16.nh (((((('platypus')'ornithorhynchus')'ornithorhynchidae' ...: ...thryonomys')'thryonomyidae')'hystricognath rodents')'hystricognatha',(((allactaga balikunica','allactaga bullata','allactaga elater','allactaga euphratica ... http://bcc.seu.ru/programs/rodent/species.html ЦОДП - Грызуны бывшего СССР- Виды: 49, Малый тушканчик, Small Five-toed Jerboa, Allactaga elater. 50, Тушканчик Виноградова, Vinogradov's Jerboa, Allactaga vinogradovi. ... http://www.ingenta.com/isis/browsing/TOC/ingenta?issue=pubinfobike://bsc/joa/2003/00000202/00000004 Ingenta: Table of Contents -- Journal of Anatomy, April 2003 ...: 5. Immunocytochemical characteristics of elbow, knee and ankle muscles of the five-toed jerboa (Allactaga elater) Jouffroy FK; Medina MF; Renous S.; Gasc JP ... http://slides-www.ucsc.edu/dbms.acgi$nxtpg.2&Set&13.9 Record List: Asiatic elephants. 1969. V000MUR687 CRM996 AD, Rodentia, Myospalax myospalax. Siberian Zokor. V000MUR687 DIA416 AC, Rodentia, Allactaga elater. Five-toed Jerboa. ... http://slides-www.ucsc.edu/subjects/dbms.acgi$BrRecs?12.279 Record List: Call Number, Main Entry, Title, Title Date. Search results: Displaying 3 of 3 records found. V000MUR687 DIA416 AC, Rodentia, Allactaga elater. Five-toed Jerboa. ... http://isb.ri.ccf.org/biomch-l/archives/biomch-l-2003-06/00020.html literature update: Renous S. Gasc JP. Immunocytochemical characteristics of elbow, knee and ankle muscles of the five-toed jerboa (Allactaga elater) Journal of Anatomy. ... http://www.ecology.samara.ru/Steppe/zhiv.html ПравоваÑ? информациÑ? в облаÑ?ти ...: СаратовÑ?каÑ? обл., ОзинÑ?кий район. 05/98. Тушканчик малый (Allactaga elater). КазахÑ?тан ... http://www.signaling-gateway.org/molecule/query?afcsid=A002368&type=blast&adv=latest Blast data for AfCS protein A002368 - Signaling Gateway: 0.00E0, 631.713, 84.39, 14.58, Von Willebrand factor (Fragment) [Allactaga elater (small five-toed jerboa ... http://cyrille.deliry.free.fr/mammal/mammal.htm Mammifères d'Europe (Essai): ...- ... Stylodipus telum (Lichtenstein, 1823) - Localisé. Allactaga elater (Lichtenstein, 1828) - Localisé. Alactaga major (Kerr, 1792) - Localisé. ... http://exon.bic.nus.edu.sg/~meena/sege/gb128/gbrod1.101 47948_AAU83812 Akodon andinus NADH dehydrogenase subunit 3 (ND3) ...: 98) MSPIFINLTLAFSLSLLGTLMFRSHLMSSLLCLEGMMLSLFIMTSASSLNTNSMTFFPIPITILVFAACEAAVGLALLVKVSSTYGTDYVQNLNALQC > 48108_AEL389534 Allactaga elater mitochondrial cytb ... http://www.chickest.udel.edu/orthomouse/m273.html BLAST Search Results: 77 3e-12 emb|AJ224667.1|GVAJ4667 Glaucomys volans VWF gene, exon 28 77 4e-12 emb|AJ224661.1|AEAJ4661 Allactaga elater VWF gene, exon 28 77 4e-12 emb|AJ278156.1 ... http://www.chickest.udel.edu/orthomouse/m140.html BLAST Search Results: 92 9e-16 emb|AJ224661.1|AEAJ4661 Allactaga elater VWF gene, exon 28 92 9e-16 ref|XM_002097.6| Homo sapiens integrin, alpha 10 (ITGA10), ... ... http://pets.club90.co.il/modules.php?op=modload&name=News&file=article&sid=640 Тушканчики :: Ð’Ñ?е о наших любимцах ! ...: Малый тушканчик (Allactaga elater); Мохноногий тушканчик (Dipus sagitta). ДЛЯ ПОЛЬЗОВÐ?ТЕЛЕЙ ... http://biodiversity.iucnp.org/MammalsOfPak.htm Biodiversity Programme - IUCN Pakistan: Pygmy Jerboa; Allactaga elater – Small Five-toed Jerboa; Allactaga hotsoni – Hotson’s Five-toed Jerboa; Allactaga euphratica ... http://www.press.jhu.edu/books/walkers_mammals_of_the_world/refs/walker.ref-b.html Literature Cited, B: Res. 10:259-67. Bekenov, A., and J. Mirzabekov. 1977. Reproduction of Allactaga elater in north Kyzylkum and Ustyurt. Zool. Zhur. 56:769-78. Bekoff, M. 1975. ... http://bioinfo.hku.hk/db/cutg/gbrod.spsum Acomys cahirinus: 2 1 12 8 4 1 4 2 7 11 3 1 6 3 12 2 3 13 2 5 16 2 ...: 6 14 0 11 6 0 6 1 0 11 12 1 5 14 3 1 3 9 10 0 4 12 6 2 4 9 7 1 3 8 2 14 6 6 0 10 2 4 2 7 3 9 6 3 0 20 10 7 23 21 2 0 0 1 11 Mitochondrion Allactaga elater: 1 8 ... http://newman.baruch.cuny.edu/digital/2000/honors/dempsey_1991/dempsey_1991.htm Baruch Undergrad. Honors [1991]: Dempsey, M. Cranial Foramina...: 58777 M, W of Sair Usu, Mongolia; 256507 F, Trans-Altai Gobi, Mongolia. Allactaga elater. 256977 M, 256978 F, Alma-Ata Oblast, Kazakhstan; Allactaga major. ... http://www.mujweb.cz/Veda/traxler/rongul.htm ordo : RONÄœULOJ - Rodentia - hlodavci: ...genro : HELAMISO - Allactaga. specio : helamiso granda - Allactaga major - frÄ?ek vÄ›tÅ¡Ã. specio : helamiso malgranda - Allactaga elater - frÄ?ek menÅ¡Ã. ... http://www.exotics.ru/rodents/10.htm ÐкзотичеÑ?кие животные Ñ€Ñ?дом Ñ? нами: Тушканчики. Малые тушканчики (Allactaga elater). Ð?овоÑ?ти. Рептилии. БеÑ?позвоночные. Грызуны. ... http://fatigue-4.jeekim.com/ fatigue, hair loss, hair growth, alopecia, and baldness: research ...: ...of SPECT; Immunocytochemical characteristics of elbow, knee and ankle muscles of the five-toed jerboa (Allactaga elater). The Canadian ... http://cgi.mitchelljones.plus.com/cgi-bin/countriesform.php Species list: ...- cgi.mitchelljones.plus.com/cgi-bin/countriesform.php - 15k - Supplemental Result - Cached - Similar pages [PDF] NEWSLETTER RAT NET 03 VOL 4 OCT - PRIYA.pmdFile Format: PDF/Adobe Acrobat - View as HTMLPage 1. Rat-a-tattle - RILSCINSA Newsletter, Volume 3, Number 1, October 2003 Newsletter of the Rodentia, Insectivora, Lagomorpha ... http://www.cse.ucsc.edu/research/compbio/yeast-protein-predictions/Q010/Q0105/Q0105.t2k.pa.html a2m2html output for file tmp.a2m: ...gi|18072448|emb|CAC80529.1|_2:378 cytochrome b [Allactaga elater]. gi|22594819|gb|AAN02418.1|_2:376 cytochrome b [Varicorhinus mariae]. ... http://www.cse.ucsc.edu/research/compbio/yeast-protein-predictions/YNR0/YNR008W/YNR008W.t2k.pa.html a2m2html output for file tmp.a2m: ...gi|11561780|emb|CAC18112.1|_2:267 Lecithin-cholesterol acyl transferase [Allactaga elater]. gi|21302718|gb|EAA14863.1|_19:442 agCP4809 [Anopheles gambiae str. ... http://www.unireptile.com.hk/Mammalia/Mammalia_web_E.htm Unireptile_°ê»Úª¦Âκô: Middle East General Care: Scientific Name: Allactaga Elater Common Name: Five-toe jerboa Original Place: Middle East General Care: http://www.altermar.boom.ru/Tush/Tush_small.htm Малый тушканчик (Allactaga elater): Малый тушканчик (Allactaga elater). МногочиÑ?ленный вид грызунов. Длина тела до 13 Ñ?м. ... http://cgi.european-mammals.org/php/countriesform.php Species list: ...cgi.european-mammals.org/php/countriesform.php - 15k - Cached - Similar pages The EMMA Databasecgi.european-mammals.org/php/mapmaker.php - 19k - Cached - Similar pages order family Genus species mass(g) gestation(mo) newborn(g) ... ... Rodentia Dipodidae Allactaga sibirica 117.50 -999.00 -999.00 -999.00 -999.00 -999.00 -999 -999.00 1.00 "1,2" Rodentia Dipodidae Allactaga elater 58.67 -999.00 ... http://cgi.european-mammals.org/php/mapmaker.php The EMMA Database: ...cgi.european-mammals.org/php/mapmaker.php - 19k - Cached - Similar pages order family Genus species mass(g) gestation(mo) newborn(g) ... ... Rodentia Dipodidae Allactaga sibirica 117.50 -999.00 -999.00 -999.00 -999.00 -999.00 -999 -999.00 1.00 "1,2" Rodentia Dipodidae Allactaga elater 58.67 -999.00 ... http://www.esapubs.org/archive/ecol/E084/093/Mammal_lifehistories_v2.txt order family Genus species mass(g) gestation(mo) newborn(g) ...: Rodentia Dipodidae Allactaga sibirica 117.50 -999.00 -999.00 -999.00 -999.00 -999.00 -999 -999.00 1.00 "1,2" Rodentia Dipodidae Allactaga elater 58.67 -999.00 ... http://www.infobiogen.fr/db/cutg/CUTG/gbrod.spsum Abrothrix jelskii: 1 0 2 1 0 1 0 1 1 4 2 1 1 1 7 0 4 6 0 1 5 0 2 2 ...: 1 12 13 0 10 6 0 7 1 0 14 7 0 7 14 4 0 3 6 10 1 6 9 7 5 4 6 3 2 4 9 1 13 8 4 2 11 1 5 1 4 5 12 4 3 0 22 6 9 24 23 2 2 1 0 9 mitochondrion Allactaga elater: 1 8 ... http://team-dew.narod.ru/articles/tush.htm (C) Юный натуралиÑ?Ñ‚: Малый тушканчик - Allactaga elater. МногочиÑ?ленный вид грызунов. Длина тела до 13 Ñ?м. ... http://www.bcc.seu.ru/programs/rodent/species/pygeretmus_zhitkovi.html ЦОДП - Грызуны бывшего СССР- Виды ...: вÑ?тречающегоÑ?Ñ? также Ñ?овмеÑ?тно малого тушканчика ( Allactaga elater ) отличаетÑ?Ñ? отноÑ?ительно ... http://nuratau.nature.uz/eng/env/834.htm 8.3.4 The Mammals (Mammalia) of the Project Area: ...mountains only. The desert is inhabited additionally by Rhombomys opimus, Allactaga elater, Vormela peregusna and Vulpes korsak. Several ... http://nuratau.nature.uz/rus/env/834.htm 8.3.4 Млекопитающие (Mammalia) проектной ...: Ко вÑ?ему прочему пуÑ?тыню наÑ?елÑ?ÑŽÑ‚ Rhombomys opimus, Allactaga elater, Vormela peregusna и Vulpes korsak. ... http://members.tripod.com/rodentvzw/rodentnederlands/Taxonomie/dipodidae.htm Dipodidae: ...- Dipodidae. Subfamilie Allactaginae. Allactaga. Allactaga bullata. Allactaga elater. Allactaga euphratica. Allactaga firouzi. Allactaga hotsoni. Allactaga major. ... http://srs.sanger.ac.uk/srs5bin/cgi-bin/wgetz?-id+2keC41M2si1+%5Bswall-AccNumber:Q8WEW8%5D+-e [an error occurred while processing this directive] Allactaga elater [an error occurred while processing this directive] 853 Small Five-Toed Jerboa Small Five-Toed Jerboa Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |