|
|
Astatotilapia velifer -IUCN Status: VulnerableIUCN Species Profile http://www.cichlid-forum.com/articles/species_list_victoria.php List of Victoria Basin Cichlid Species: Astatotilapia spot bar. Astatotilapia straeleni. Astatotilapia thick skin. Astatotilapia velifer. Astatotilapia vicatius. Cychlopharynx. Cychlopharynx fwa. ... http://www.webcityof.com/miff1010.htm Master Index of Freshwater Fishes (Astatichthys coeruleus ...: ...multicolor Astatotilapia swynnertoni See Haplochromis swynnertoni Astatotilapia tweddlei See Haplochromis tweddlei Astatotilapia velifer See Haplochromis ... http://www.webcityof.com/miff1044.htm Master Index of Freshwater Fishes (Haplochomis borleyi ...: ...vanderhorsti Haplochromis VC 10 See Eclectochromis milomo Haplochromis velifer (Trewavas 1933, Ax:424) Astatotilapia velifer Haplochromis 'Velvet Black' See ... http://aexchange.addr.com/redlist.htm Victorian Cichlids and Related Species on the 2000 Red List: ...evaluated. Astatotilapia piceata, Endangered in Lake Victoria. Astatotilapia velifer, Vulnerable in Nabugabo Lakes. Enterochromis, Enterochromis ... http://www.ciklidi.org/ftopic105.html CIKLIDI.ORG :: Pogledaj temu - Jezero Victoria: ...schubotziellus Astatotilapia shovel mouth Astatotilapia spot bar Astatotilapia straeleni Astatotilapia thick skin Astatotilapia velifer Astatotilapia vicatius ... http://www.africancichlids.net/species_index.html AfricanCichlids.net - The Gas Station - African Cichlids - Lake ...: Astatotilapia straeleni, Astatotilapia thick skin, Astatotilapia velifer, Lake Nabugabo, Astatotilapia vicatius, Lake Edward, Cychlopharynx fwa, Fwa River, ... http://listserv.nic.museum/cgi-bin/wa?A2=ind0101&L=cichlid-l&F=&S=&P=407 CICHLID-L archives -- January 2001 (#4): Astatotilapia velifer 11. Chetia brevis 12. Cichlasoma bartoni 13. Cichlasoma labridens 14. Cichlasoma minckleyi 15. Cichlasoma pantostictum 16. ... http://listserv.nic.museum/cgi-bin/wa?A2=ind9601&L=cichlid-l&F=&S=&P=5851 CICHLID-L archives -- January 1996 (#92): Paralabidochromis beadlei abundance not too impressive, but hard to gauge due to seasonal movements. Astatotilapia velifer secure. ... http://www.gpcr.org/7tm/htmls/entries_org.html GPCRDB GPCR entries: Q8AUP1 (Q8AUP1) LWS fragment Astatotilapia velifer. Q8AUU9 (Q8AUU9) SWS 2B fragment Astatotilapia velifer. Q8AUZ6 (Q8AUZ6) LWS fragment Astatotilapia velifer. ... http://www.gpcr.org/7tm/seq/DR/Q8AUU9.TABDR.html GPCRDB Cross References for Q8AUU9: Description, Short wavelength-sensitive opsin 2B (Fragment). Gene, SWS 2B. Organism, Astatotilapia velifer. Chromosomal location, -. Gene Ontology, QuickGO. ... http://planeta.terra.com.br/lazer/cmca/em_perigo.htm EM PERIGO: ...- ... reavaliado. Astatotilapia piceata, em perigo no lago Victoria. Astatotilapia velifer, vulneravel no lago Nabugabo. Enterochromis, Enterochromis ... http://www.cichlidae.ch/artenlisten/roteliste.html www.cichlidae.ch - Cichliden auf der Roten Liste (IUCN): ...- ... ausgestorben. Astatotilapia piceata. gefährdet. A1ace, B1+2acd. Astatotilapia velifer. anfällig. A1ae, B1+2c. Chetia. Chetia brevis. anfällig. A1e. Cichlasoma. ... http://genome.jouy.inra.fr/db/gcg/sptrembl/sptr_mhc_000.seq Q95I82 6/2003 ASCII Len: 70 Q95i82 stizostedion vitreum. major ...: ...mhc class ii antigen b (fragment). 6/2003 ERVRYVERYIYNRGQYVHFDSDLGHYVADTPLGKPTADYWNSQPETLEDARAA >>>>Q9MW56 6/2003 ASCII Len: 55 Q9mw56 astatotilapia velifer. ... http://aquadb.nrifs.affrc.go.jp/~aquadb/cgi-bin/tax_hl.cgi?TTAXID=8153&LANG=en Tax Data: ...species, Astatotilapia bloyeti, ddbj information. species, Astatotilapia velifer, ddbj information. genus, Simochromis, genus, Geophagus, genus, Asprotilapia, ... http://aquadb.nrifs.affrc.go.jp/~aquadb/cgi-bin/tax_hl.cgi?TTAXID=8154 Tax Data: ...species(種), Astatotilapia bloyeti, ddbj information. species(種), Astatotilapia velifer, ddbj information. genus(属), Simochromis, genus(属), Geophagus, ... http://www.infobiogen.fr/db/index-lassap/sptrembl/mhc.seq Q95I82 #AC Q95I82; #OS STIZOSTEDION VITREUM. #DE MAJOR ...: KW GLYCOPROTEIN; MHC II; TRANSMEMBRANE. ERVRYVERYIYNRGQYVHFDSDLGHYVADTPLGKPTADYWNSQPETLEDARAA >Q9MW56 #AC Q9MW56; #OS ASTATOTILAPIA VELIFER. ... http://www.infobiogen.fr/db/acnuc/hovergen/genomic/index/SPECIES JD RACINE _< UNCLASSIFIED × Ã2 _< ÿÿÿü UNCLASSIFIED. ...: ...- ... 0g LAMPROLOGUS COMPRESSICEPS ¬ ï ASTATOTILAPIA _D ASTATOTILAPIA NUBILA ÅÒ _D¢ÿÿûP HAPLOCHROMIS NUBILUS ¯ 1 ASTATOTILAPIA VELIFER ÅÓ _D¤ÿÿûN ... http://www.genomics.purdue.edu/~jxu/Fgr/S/blast/Fgr-S_4_D11_T7.blastx.html NCBI BLAST Search Results: 30 7.0 gb|AAB70196.1| (AF015022) cytochrome b [Astatotilapia velifer] 30 7.0 gb|AAK15143.1|AF240751_1 (AF240751) cytochrome b [Lethrinus... ... http://www.blackwell-synergy.com/links/doi/10.1046/j.1523-1739.2003.01519.x/full/ [an error occurred while processing this directive] Astatotilapia velifer [an error occurred while processing this directive] 2199 Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |