|
|
Ateles belzebuth - Long-Haired Spider Monkey, White-Bellied Spider Monkey, Atèle Belzébuth, Macaco Aranha, Maquisapa, Mono Araña Común, Mono Araña De Vientre AmarilloIUCN Status: VulnerableIUCN Species Profile http://www.sanmartinzoo.org/images/animals/spidermonkeyANDEAN.html Spider Monkey - Ateles belzebuth: ¡Lea esta página en español! Return to Zoo Photos. Spider Monkey Ateles belzebuth (White-bellied). SEE SPECIES INFORMATION BELOW. ... http://www.sanmartinzoo.org/images/animals/spidermonkey2.html Spider Monkey - Ateles belzebuth: Threatened Andean Species at the Ecozoological San Martin. Spider Monkey Ateles belzebuth. Belzebuth de Ateles del mono de la araña. ... http://members.tripod.com/uakari/ateles_belzebuth.html Long-haired Spider Monkey (Ateles belzebuth): Long-haired Spider Monkey (Ateles belzebuth). MORPHOLOGY: The long-haired spider monkey has a prehensile tail which it uses for grasping when feeding and when ... http://members.tripod.com/cacajao/ateles_links.html Ateles Links: Ateles Links. Primatis: Ateles belzebuth (Long-haired Spider Monkey) (in German) Centro Nacional de Primatas: Ateles belzebuth (Long-haired Spider Monkey) (in ... http://www.itis.usda.gov/servlet/SingleRpt/SingleRpt?search_topic=TSN&search_value=572954 ITIS Standard Report Page: Ateles belzebuth: Go to Print Version, Ateles belzebuth É. Geoffroy Saint-Hilaire, 1806 Taxonomic Serial No.: 572954. ... Geoffroy Saint-Hilaire, 1806, Species, Ateles belzebuth É. ... http://www.itis.usda.gov/servlet/SingleRpt/RefRpt?search_type=expert&search_id=expert_id&search_id_value=40 ITIS 'Expert(s)' Search results for Colin P. Groves: Ateles É. Geoffroy Saint-Hilaire, 1806 -- valid. Ateles belzebuth É. Geoffroy Saint-Hilaire, 1806 -- valid -- white-bellied spider monkey. ... http://spidermonkey.zoodoue.fr/2001-EAZA-Ateles-belzebuth-studbook.htm Ateles-belzebuth-studbook: Ateles belzebuth. Compiled by: Pierre Gay. Zoo De Doue. ... Data current as of 31 December 2001. WHITE-BELLIED SPIDER MONKEY Studbook(Ateles belzebuth belzebuth). ... http://spidermonkey.zoodoue.fr/Ateles-belzebuth.htm Ateles-belzebuth: Ateles belzebuth. Vernacular names: Long-haired spider monkey; white- bellied spider monkey. Physical characteristics The dorsal surface ... http://www.redlist.org/search/details.php?species=2276 IUCN Red List of Threatened Species - Ateles belzebuth: Ateles belzebuth. Taxonomy. Kingdom, ANIMALIA. Phylum, CHORDATA. ... Citation: Brazil Threatened Species Workshop participants 2003. Ateles belzebuth. In: IUCN 2003. ... http://www.primatis.de/primaten/fakten.asp?ID=2113201 primatis.de - Ordnung und Steckbriefe der lebenden Primatenarten: ...- Affen, unsere tierischen Verwandten. primatis.de - das Primateninformationssystem. ... http://www.damisela.com/zoo/mam/primates/cebidae/belzebuth/ Atelo Peludo: ...- Atelo Peludo. Ateles belzebuth. ... http://www.damisela.com/zoo/mam/primates/cebidae/belzebuth/taxa.htm Ateles belzebuth: ...- Atelo Peludo. Ateles belzebuth. TaxonomÃa. El ... 1806. El Atelo Peludo ( Ateles belzebuth ) en el Reino Animal. CategorÃa, Taxa, Descripción. ... http://www.cenp.org.br/ficha.asp?idespecie=3&id=5 Centro Nacional de Primatas: ...- ... Ananindeua - PA - Brasil. Guia das espécies, :: Ateles belzebuth marginatus, Nome Popular: Coatá-de-testa-branca. Biologia:formam ... http://alejandria.hacer.ula.ve/cgi-win/be_alex.exe?Autor=Ateles+belzebuth+hybridus&Nombrebd=lib_rojo lib_rojo Autor: AlejandrÃa BE 5.3.8.0r: ...- ... Autor: Ateles belzebuth hybridus (Comienzo). ... Autor: Ateles belzebuth hybridus. TÃtulo: MONO ARAÑA DEL NORTE. Mono frontino. Long-haired Spider Monkey. ... http://alejandria.hacer.ula.ve/cgi-win/be_alex.exe?Descriptor=Roberta+Bodini&Nombrebd=lib_rojo lib_rojo Descriptor: AlejandrÃa BE 5.3.8.0r: ...- ... Autor: Ateles belzebuth hybridus. TÃtulo: MONO ARAÑA DEL NORTE. ... Mondolfi, E. & JF Eisenberg (1979) New records of Ateles belzebuth in Northern Venezuela. ... http://merops.sanger.ac.uk/speccards/peptidase/sp002149.htm Peptidase of Ateles belzebuth (Chamek spider monkey): Ateles belzebuth (Chamek spider monkey). TAXONOMY. Taxonomy database identifier: 118643. Superkingdom, Eukaryota. Kingdom, Animalia. Subkingdom, Metazoa. ... http://www.ipbir.org/ipbir_cgi/tax.cgi?mode=2&id=2&lvl=1 IPBIR: Integrated Primate Biomaterials and Information Resource ...: ...born. PR00089, Ateles belzebuth hybridus, white-bellied (long-haired) spider monkey, Cell Culture Skin, 8 YR, Male, zoo born. PR00090, Ateles ... http://www.ipbir.org/ipbir_cgi/tax.cgi?mode=2&id=17&lvl=3 IPBIR: Integrated Primate Biomaterials and Information Resource ...: Origin. PR00089, Ateles belzebuth hybridus, white-bellied (long-haired) spider monkey, Cell Culture Skin, 8 YR, Male, zoo born. PR00090, ... http://www.povodok.ru/encyclopedia/brem/list19rus/art3263.html СветлолобаÑ? коата (Ateles belzebuth) ...: СветлолобаÑ? коата (Ateles belzebuth). ... http://www.thebigletterlist.net/word/b-Belzebuth.html Belzebuth: Belzebuth (n.): A spider monkey (Ateles belzebuth) of Brazil. ... Belzebuth (n.). A spider monkey (Ateles belzebuth) of Brazil. Belzebuth Alltheweb Results. ... http://content.karger.com/ProdukteDB/produkte.asp?Aktion=ShowAbstract&ProduktNr=223842&Ausgabe=225012&ArtikelNr=21573 Karger Publishers: Diet and Feeding Ecology of Ateles belzebuth belzebuth at Maracá Ecological Station, Roraima, Brazil Andraé Nunes Departamento de Zoologia, Museu Paraense ... http://www.primate.wisc.edu/pin/factsheets.html PIN: Fact Sheets: Ateles (Spider monkey) Mindy's Memory: Ateles (Spider Monkey) Monkeyland: Ateles (Spider monkey) Centro Nacional de Primatas: Ateles belzebuth (Long-haired ... http://www.primate.wisc.edu/pin/images/ateles.html WPRC Primate Image Collection: Ateles sp. Infant Photographer: John Hampton, Slide #001194 Ateles belzebuth marginatus Photographer: Luiz Claudio Marigo. Slide #001988 ... http://intron.bic.nus.edu.sg/chk/gbpri3.out Seq ID=LOCUS AACCOSIV1 168 bp DNA PRI 26-JAN-1998 ORGANISM Aotus ...: ...- ... as nCDS=0 ===== Seq ID=LOCUS ABU59647 1074 bp mRNA PRI 22-JAN-1998 ORGANISM Ateles belzebuth Eukaryota; Metazoa ... http://www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=Ateles+belzebuth+%5Bgbpri%5D Codon usage table: Ateles belzebuth [gbpri]: 4 CDS's (656 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU 22.9( 15) UCU 13.7( 9) UAU ... http://www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=mitochondrion+Ateles+belzebuth+chamek+%5Bgbpri%5D Codon usage table: ...mitochondrion Ateles belzebuth chamek [gbpri]: 8 CDS's (1849 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU ... http://www.brenda.uni-koeln.de/sequences/seq_tsv_EC_download.php4?ec=1.9.&type=fasta Q01519 | cytochrome-c oxidase | 1.9.3.1 | Saccharomyces cerevisiae ...: QAMLASMRPGLFYGQCSEICGSNHSFMPIVLEFIYFQDFEVWASYLYIVSL >Q8M4R5 | cytochrome-c oxidase | 1.9.3.1 | Ateles belzebuth chamek | TREMBL ... http://home.t-online.de/home/othmar.bahner/Primats/03.htm Die Ordnung der Primaten: Affen: ...- ... Linné, 1758). 3.1.1.37 Ateles belzebuth. Goldstirn-Klammeraffe, Ateles belzebuth E. Geoffrey, 1806. 3.1.1.38 Ateles fusciceps. Braunkopf ... http://www.pri.kyoto-u.ac.jp/shakai-seitai/shakai/shimooka/shimooka03.htm 下岡ゆã??å? ç ”ç©¶æ¦‚è¦?: ...ãƒžã‚«ãƒ¬ãƒŠéœŠé•·é¡žç ”ç©¶ã‚»ãƒ³ã‚¿ãƒ¼ï¼ˆCIEM)ã?§ã€?ケナガク モザル(Ateles belzebuth)ã?®ç¤¾ä¼šæ§‹é€ （離å?ˆé›†æ•£æ€§ï¼‰å?Š ã?³ ... http://www.pri.kyoto-u.ac.jp/shakai-seitai/shakai/shimooka/shimooka02.htm shimooka: ...å?—米コãƒãƒ³ãƒ“ア共和国マカレナ国立公園ã?§ã€?ケナガ クモザル(Ateles belzebuth)ã?®ç¤¾ä¼šæ§‹é€ （離å?ˆé›†æ•£æ€§ï¼‰å?Š ã?³ ... http://www.primatesmx.com/Ateles.htm Ahumada J: Castellanos, HG (1995). Feeding behaviour of Ateles belzebuth E. Geoffroy 1806 (Cebidae: Atelinae) in Tawadu forest southern Venezuela. ... http://www.funet.fi/pub/sci/bio/life/mammalia/primates/cebidae/ateles/ Ateles: Paris 7: 262 N.Brazil, Venezuela, Colombia, Ecuador, N.Peru. See [About maps]. Ateles belzebuth Geoffroy, 1806 Ateles belzebuth Geoffroy, 1806; Ann. Mus. Hist. ... http://www.infochembio.ethz.ch/links/zool_saeuget_affenneu.html Neuweltaffen: Säugetiere: Long-haired Spider Monkey (Ateles belzebuth) - Text. ... White-bellied Spider Monkey (Ateles belzebuth) - Text and Images. White-Faced Saki - Text and Image. ... http://www.origins.tv/darwin/zoo/newmonk.htm Zoology -- New World Monkeys: Woolly Monkey -- [ nyu ] Ateles belzebuth -- Long-haired Spider Monkey -- [ wisc | *aniz | *nyu | *peru (see below) ]: Ab brunneus ... http://www.origins.tv/darwin/zoo/peru4.htm Zoology -- Primates -- Peruvian Artwork4: Ateles chamek Black-faced Spider Monkey (below). Ateles belzebuth Long-haired Spider Monkey (above) Ateles hibridus Variegated Spider Monkey (below). ... http://www.geobrasil2001.hpg.ig.com.br/grupo02/animais_em_extincao.htm ANIMAIS EM EXTINÇÃO: ...- ... Geoffroy, 1812) – bugio. Ateles belzebuth É. Geoffroy, 1806 – macaco-aranha. ... FamÃlia CEBIDAE - barbado, guariba. Ateles belzebuth (E. Geoffoy, 1806). ... http://gibbon.anat.sunysb.edu/IDPAS/Suarez.htm Scott Suarez: ...data on The Fission-Fusion Social Organization, and its relation to Spatial and Temporal Mapping in Long-Haired Spider Monkeys (Ateles belzebuth belzebuth) in ... http://www.mindysmem.org/spider.html Mindy's Memory - Spider Monkey Facts: Newland K 1997 NORTH AMERICAN REGIONAL (HISTORICAL) STUDBOOK FOR SOUTH AMERICAN SPIDER MONKEYS, ATELES BELZEBUTH, A. FUSCICEPS, A. PANISCUS--ALL SUBSPECIES. ... http://www.monkeymaddness.com/taxonomy_photos/species.html Monkey Maddness - Taxonomy List: ...cheeked Cercocebus albigena Mangabey, white-collared Cercocebus torquatus Mangabey, white-crowned Cercoebus torquatus Marimonda Ateles belzebuth Marmoset, bare ... http://perso.club-internet.fr/boudetjo/ZooList/Mammif/Dangprim.html Primates en danger: CITES - Appendix II. Ateles belzebuth, Singe-araignée à ventre blanc, White-bellied Spider Monkey, Long-haired Spider Monkey, é. Geoffroy, 1806. ... http://www.primatestore.com/taxonomycommon.htm Primate Taxonomy Common -> Primate Scientific Names: ...torquatus White-crowned mangabey - Cercoebus torquatus. Marimonda Ateles belzebuth. Marmoset. Bare-eared marmoset - Callithrix argentata ... http://www.primatestore.com/taxonomyscientific.htm Primate Taxonomy Scientific -> Primate Common Names: Ateles belzebuth - Long-haired spider monkey Ateles fusciceps - Brown-headed spider monkey Ateles geoffroyi - Geoffroy's spider monkey Ateles paniscus - Black ... http://www.animalinfo.org/country/colombia.htm Animal Info - Colombia: ...(Recognized as a subspecies, Ateles belzebuth hybridus, in 1996.). Vulnerable: Amazonian Manatee (Trichechus inunguis). American Manatee (Trichechus manatus). ... http://www.animalinfo.org/country/venezuel.htm Animal Info - Venezuela: ...(Recognized as a subspecies, Ateles belzebuth hybridus, in 1996.); Venezuelan Fish-eating Rat (Neusticomys venezuelae). Vulnerable ... http://www.nyu.edu/projects/difiore/Yasuni/primates.html Primate Research in Yasuni National Park, Ecuador: COMMON NAME. SCIENTIFIC NAME, White-bellied spider monkey. Atelinae, Ateles belzebuth belzebuth. Lowland woolly monkey. Lagothrix lagotricha poeppigii. ... http://www.nyu.edu/projects/difiore/Yasuni/research.html Primate Research in Yasuni National Park, Ecuador: Dissertation abstract: Synecology and seed dispersal in woolly monkeys (Lagothrix lagotricha poeppigii) and spider monkeys (Ateles belzebuth belzebuth) in ... http://www.icb.ufmg.br/~primatas/bdp_tsubspecies.htm Number fo Records by Family, Genus, Species and Subspecies: ...- ... 3. Alouatta seniculus stramineus, 133. Alouatta seniculus stramineus ? 3. Ateles, 268. Ateles belzebuth, 26. Ateles belzebuth, 25. Ateles belzebuth ? 1. Ateles chamek, 59. ... http://www.icb.ufmg.br/~primatas/bdp_tsspbiome.htm Number of Records by Biome, Genus, Species and Subspecies: ...- ... 3. Aotus vociferans, 5. Aotus vociferans, 5. Ateles, 114. Ateles belzebuth, 17. Ateles belzebuth, 16. Ateles belzebuth ? 1. Ateles chamek, 49. Ateles chamek, 49. ... http://156.99.114.200/abstracts/Abs70259.asp ISIS Abstracts: Ateles belzebuth Long-haired spider monkey. Range: COLOMBIA,NORTHWEST BRAZIL. ... Totals, 6, 19, 0, 0. Ateles belzebuth <<< Hybrid >>> Long-haired spider monkey. ... http://www.primates.com/classification/ Living Primates: Alouatta pigra). Ateles: (Ateles belzebuth) Long-haired spider monkey; (Ateles fusciceps) Brown-headed spider monkey; (Ateles geoffroyi ... http://www.fpolar.org.ve/librorojo/mamiferos.htm Libro Home: ...- ... MARGAY Leopardus wiedii. MONO ARAÑA DEL NORTE Ateles belzebuth hybridus. MONO ARAÑA DEL SUR Ateles belzebuth belzebuth. MONO CHUCUTO Cacajao melanocephalus. ... http://www.fpolar.org.ve/librorojo/listaroja.htm Libro Home: ...- ... Cuspón - Priodontes maximus Murciélago narigudo - Lonchorhina fernandezi Mono araña del norte - Ateles belzebuth hybridus Oso frontino - Tremarctos ornatus ... http://home.globalcrossing.net/~brendel/primate.html PRIMATES (prosimians, monkeys, apes and humans): ...monkey). Alouatta pigra. Genus Ateles. Ateles belzebuth (long-haired spider monkey) Ateles fusciceps (brown-headed spider monkey). Ateles ... http://www.das-tierlexikon.de/a_lat.htm A lat: Arvicola terrestris terrestris. Ascidiacea. Ateles. Ateles belzebuth. Ateles fusciceps (B). Ateles geoffroyi (B). Ateles paniscus. Atherurus. Atherurus africanus. ... http://www.das-tierlexikon.de/inhalt_g.htm Gibbons, Langarmaffen oder niedere Menschenaffen: ...- ... Aotes. - Aotes trivirgatus (B). - Apella (B). - Ateles. - Ateles belzebuth. - Ateles fusciceps. - Ateles geoffroyi (B). - Ateles paniscus. - Bartsakis. ... http://encyclopedia.thefreedictionary.com/Atelidae Atelidae - encyclopedia article about Atelidae. Free access, no ...: ...classification Kingdom: Animalia Phylum: Chordata Class: Mammalia Order: Primates Family: Atelidae Genus: Ateles Species Ateles belzebuth Ateles chamek Ateles ... http://arc.cs.odu.edu:8080/dp9/getrecord/oai_dc/harvester.pkp.ubc.ca/oai:harvester.pkp.ubc.ca:record/6944 Evolución cromosómica en Simiiformes: homologí ...: ...- ... cromosomas humanos completos, ha permitido determinar las homologías entre la especie humana (HSA), Cebus apella (CAP) y Ateles belzebuth hybridus (ABH ... http://en.wikipedia.org/wiki/Atelidae Atelidae - Wikipedia, the free encyclopedia: ...pigra; Red Howler Monkey, Alouatta seniculus. Subfamily Atelinae: Genus Ateles: Long-haired Spider Monkey, Ateles belzebuth; Black-faced ... http://geocities.yahoo.com.br/segredosdemacaco/primato3.htm Macacos no CD-Book: ...- ... Macaco-aranha, coatá - Ateles belzebuth; Ateles paniscus. voltar ao inÃcio. MACACOS DO VELHO MUNDO Catarrihini. - Cercopithecoidea. ... http://www.acguanacaste.ac.cr/rothschildia/v1n1/textos/06.html " La Comunicación Vocal en el Mono Araña (Ateles geoffroyi): la ...: ...- ... KLEIN, LL.1972. The ecology and social organization of the spider monkey, (Ateles belzebuth ) PhD. Thesis, University of California, Berkeley. ... http://www.fst.com.br/~paulo/extinto/a.htm Volta para página anterior: ...- ... 1865) Artibeusfimbriatus (Gray, 1838) Artibeus obscurus (Schinz,, 1821) Asthenes luizae (Vielliard, 1990) Ateles belzebuth (E. Geoffrov, 1806) Ateles belzebuth ... http://www.markuskappeler.ch/tex/texs/klammeraffe.html Geoffroy-Klammeraffe: ...- ... Den Goldstirn-Klammeraffen (Ateles belzebuth), der durch einen gelbbraunen dreieckigen Fleck an der Stirn gekennzeichnet ist, findet man in Peru, Ecuador ... http://www.siamazonia.org.pe/Material%20educativa/Fotos/Fauna/photofauna_mamiferos.htm Fotos - Fauna: ...- ... Historia. FAQ-Preguntas. Fauna - MamÃferos. Ateles paniscus 86Kb. Ateles belzebuth 104Kb. Ateles paniscus 116Kb. Ateles paniscus 121Kb. Ateles paniscus 86Kb. ... http://www.bioone.org/bioone/?request=get-abstract&issn=0006-3606&volume=032&issue=03&page=0533 Influence of Fruit Availability on Ecological Overlap among Four ...: Data on fruit abundance and ecological overlap among Ateles belzebuth, Lagothrix lagothricha, Cebus apella, and Alouatta seniculus were gathered during 13 ... http://aleph0.clarku.edu/huxley/SM2/Ateles.html On the Brain of Ateles Paniscus: On the Brain of Ateles Paniscus. Zoological Society of London (1861) Scientific Memoirs II. [493] The brain of a Spider Monkey (Ateles belzebuth) has already ... http://www.anthro.ucdavis.edu/graduate/phd-dew.htm J. Larry Dew: Synecology and Seed Dispersal in Woolly Monkeys (Lagothrix lagotricha poeppigii) and Spider Monkeys (Ateles belzebuth belzebuth) in Parque Naçional Yasunà ... http://www.georgeglazer.com/archives/prints/animals/lgmonk.html George Glazer Gallery - 4 Large Folio Lithographs Studies of ...: 177) Lasiopyga Nemaea (pl. 182) Hapale leucocephalus (pl. 145) Ateles Belzebuth (pl. ... Hapale/ Hapale leucocephalus, and Gatt. Ateles/ Ateles Belzebuth. ... http://www.snowcrest.net/goehring/a2/primates/spider.htm Scientific Name:: Normally spider monkeys have eliminated the reduced thumbs but in 20% of the Ateles belzebuth and in 8% of the Ateles geoffroyi there still exists a perfectly ... http://www.netbiologen.dk/zoologi/primater.htm Familie Cheirogaleidae: Ateles belzebuth Lang-hÃ¥ret Edderkop abe Ateles fusciceps Brun-hoved Edderkop abe Ateles geoffroyi Sort-hÃ¥ndet Edderkop abe Ateles paniscus Sort Edderkop abe. ... http://staff.washington.edu/timk/primate/photos/Cebidae/Atelinae.html CEBIDAE - Subfamily Atelinae: White-bellied Spider Monkey Ateles belzebuth E. Geoffroy, 1806 Distribution: Cordillera Oriental, Colombia to Venezuela and N Peru. ... http://staff.washington.edu/timk/primate/photos/species.html Living Primate Species: Subfamily Atelinae - Wooly and Spider Monkeys. Long Haired Spider Monkey Ateles belzebuth E. Geoffroy, 1806 Ateles chamek Ateles chamek (Humboldt, 1812). ... http://www.led.uni-stuttgart.de/hfam10.html Homologous family Hepatic lipases: 3D. Ateles belzebuth, hepatic lipase, GB, AAF21855, Ateles belzebuth chamek hepatic lipase (LIPC) gene, exon 5 and partial cds. Bombyx ... http://www.asp.org/asp2002/abstractDisplay.cfm?abstractID=339&confEventID=290 Abstract for the The Twenty-fifth ASP Meeting: Poster Presentation. BEHAVIORAL ECOLOGY OF THE WHITE-BELLIED SPIDER MONKEY (ATELES BELZEBUTH BELZEBUTH) IN EASTERN ECUADOR. SA Suarez ... http://www.asp.org/meetings/archive/TaxonomicIndex_2002.html ASP 2002 Taxonomic Index: Aotus trivirgatus [87] [113]. Ateles [41]. Ateles b. belzebuth [41]. Ateles belzebuth belzebuth [41]. Avahi [20]. Bonobo [83] [115] [120]. C. goeldii [119]. ... http://www.dictionarybarn.com/BELZEBUTH.php Dictionary definition of BELZEBUTH: ...linens bede. <zoology> A spider monkey (Ateles belzebuth) of Brazil. Origin: From Beelzebub. Source: Websters Dictionary. Please select ... http://membres.lycos.fr/sosinges/menace1.htm especes en danger: ...- ... Il existe plusieurs espèces de singes araignées, les plus menacés sont : l' Ateles belzebuth ( Colombie, Peru, Brésil, Ecuador ), Ateles fusciceps (de ... http://sisbib.unmsm.edu.pe/BVRevistas/biologia/Vol10_N2/rsm_evaluaci%C3%B2n.htm evaluaciòn del estado de conservaciòn de los mamìferos de caza ...: ...- ... Finalmente, el modelo de cosecha sugiere sobrecaza para el tapir, maquisapa cenizo (Ateles belzebuth E. Geoffroy), choro (Lagothrix lagotricha Humboldt) y mono ... http://www.dpz.gwdg.de/infra/SPECIES.HTM Alphabetic List of Species Held: Ateles belzebuth: Burford, Zoo, GB (2); Duisburg, Zoo, D (2); Saarbruecken, Zoo, D (2); Wroclaw, Zoo, PL (2). Ateles belzebuth belzebuth: Bristol, Zoo, GB (4). ... http://www.receptors.org/NR/htmls/entries_org.html NucleaRDB Nuclear receptor entries: O97900 (O97900) AR fragment Ateles belzebuth chamek (Chamek spider monkey). Q9XSY5 (Q9XSY5) VDR fragment Ateles belzebuth chamek (Chamek spider monkey). ... http://www.geocities.com/RainForest/Vines/1460/mammal.html Endangered Mammals: Cebidae: Hybrid Spider Monkey (Ateles belzebuth hybridus). Daubentoniidae: Aye-aye (Daubentonia madagascariensis). ... Hybrid Spider Monkey (Ateles belzebuth hybridus). ... http://sentir.org/espeligro/listado.htm Listado de Especies en Peligro de Extinción en Colombia: ...- ... Ara militaris, Guacamayo. CI. Arapaima gigas, Pez pirarucu. **. Ateles belzebuth, Marimonda. V. Ateles fuscipens, Mono araña. V. Ateles geoffroyi, V. ... http://www.natureserve.org/infonatura/speciesIndex/Family_Atelidae_122947_1.htm InfoNatura Species Index: Family Atelidae: L000000419, Alouatta ululata A Howling Monkey, GNR, CR, 2, Countries: BR. LMHK003010, Ateles belzebuth White-bellied Spider Monkey, G3, VU, 2, Countries: BR, CO, EC, PE. ... http://www.bluemorphotours.com/animal.asp Blue Morpho Tours - Amazon Jungle Adventure Tour, Shamanic Tours ...: Common squirrel monkey, Saimiri sciureus sciureus, Boliviensis fraile. White-bellied spider monkey, Ateles belzebuth belzebuth, Maquisapa pecho amarillo. ... http://www.animalzoom.org/port/pagext3.htm www.animalzoom.org/port/pagext3.htm: Similar pages Current NYCEP PhD Students ... NYU, Stephanie Spehar, The function of the white-bellied spider monkey (Ateles belzebuth belzebuth) long call in northeastern Ecuador, ... http://www.nycep.org/pages/students/students_phd_current.php [an error occurred while processing this directive] Ateles belzebuth [an error occurred while processing this directive] 2276 Long-Haired Spider Monkey, White-Bellied Spider Monkey, Atèle Belzébuth, Macaco Aranha, Maquisapa, Mono Araña Común, Mono Araña De Vientre Amarillo Long-Haired Spider Monkey, White-Bellied Spider Monkey, Atèle Belzébuth, Macaco Aranha, Maquisapa, Mono Araña Común, Mono Araña De Vientre Amarillo Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |