|
|
Ateles geoffroyi - Black-Handed Spider Monkey, Central American Spider Monkey, Geoffroy's Spider Monkey, Mono Colorado, Atèle De Geoffroy, Mico, Mono ArañaIUCN Status: Least ConcernIUCN Species Profile http://www.geocities.com/RainForest/Canopy/4695/spider.html Monkeys Online | The Spider Monkey: ...class: Mammalia; order: Primates; family: Cebidae; species: Ateles geoffroyi Spider monkeys live in groups of two to eight. The group ... http://animaldiversity.ummz.umich.edu/accounts/ateles/a._geoffroyi ADW: Ateles geoffroyi: Information: Ateles geoffroyi (Central American spider monkey). ... Family: Cebidae. Subfamily: Atelinae. Genus: Ateles. Species: Ateles geoffroyi. Geographic Range. ... http://animaldiversity.ummz.umich.edu/site/accounts/pictures/Ateles_geoffroyi.html ADW: Ateles geoffroyi: Classification: Ateles geoffroyi (Central American spider monkey). ... Central American spider monkey Ateles geoffroyi, Central American spider monkey Ateles geoffroyi. ... http://www.csam.montclair.edu/ceterms/mammals/spidermonkey.html Mammal Directory: Spider Monkeys: Spider Monkeys (Ateles geoffroyi). ... The Barro Colorado Island spider monkey species is Ateles geoffroyi, the black-handed spider monkey. ... http://www.honoluluzoo.org/spider_monkey.htm Spider Monkey: Scientific name: Ateles geoffroyi geoffroyi Order: Primates Family: Cebidae (new world monkeys) Subfamily: Atelinae Genus: Ateles Species: Geoffroyi (Black ... http://www.oaklandzoo.org/atoz/azspdmky.html Oakland Zoo: Spider Monkey: Spider Monkey. ORDER: Primate FAMILY: Cebidae GENUS: Ateles SPECIES: geoffryi. I. DESCRIPTION: Head and body length 15 to 25 inches, tail 20 to 35 inches. ... http://www.americazoo.com/goto/index/mammals/98.htm Black-handed spider monkey: Black-handed spider monkey - ATELES GEOFFROYI. Possibly Endangered. Class: Animals with Milk Glands (Mammalia) Subclass: True Mammals ... http://www.thefreedictionary.com/Ateles%20geoffroyi Ateles geoffroyi definition of Ateles geoffroyi. What is Ateles ...: Definition of Ateles geoffroyi in the Dictionary and Thesaurus. Ateles geoffroyi in Free online English dictionary, thesaurus and ... http://www.thefreedictionary.com/Ateles Ateles definition of Ateles. What is Ateles? Meaning of Ateles. ...: Ateles geoffroyi, spider monkey - arboreal monkey of tropical America with long slender legs and long prehensile tail. Legend: Synonyms Related Words Antonyms. ... http://www.hensonrobinsonzoo.org/k001.html Spider Monkey: BROWN-HEADED SPIDER MONKEY (Ateles geoffroyi paniscus). Scientific Name, Ateles geoffroyi paniscus. CLASS, Mammalia, ORDER, Primate, FAMILY, Celidae. Statistics. ... http://www.itis.usda.gov/servlet/SingleRpt/SingleRpt?search_topic=TSN&search_value=572958 ITIS Standard Report Page: Ateles geoffroyi: Ateles geoffroyi Kuhl, 1820 Taxonomic Serial No.: 572958. ... Species, Ateles geoffroyi Kuhl, 1820 -- Central American spider monkey, Mono-araña centroamericano, ... http://www.primatis.de/primaten/fakten.asp?ID=2113203 primatis.de - Ordnung und Steckbriefe der lebenden Primatenarten: ...- ... Foto: Frank Preiß, WISSENSCHAFTLICH, Ateles geoffroyi. DEUTSCH, Geoffroy-Klammeraffe. ENGLISCH, Black-handed spider monkey. FRANZÖSISCH, ... http://www.primatis.de/primaten/fakten.asp primatis.de - Ordnung und Steckbriefe der lebenden Primatenarten: ...- ... Klammerschwanzaffen Art: Ateles belzebuhl - Goldstirnklammeraffe Art: Ateles fusciceps - Braunkopfklammeraffe Art: Ateles geoffroyi - Geoffroy-Klammeraffe Art ... http://www.saudeanimal.com.br/m_aranha.htm Saúde Animal - Zoo Virtual - MACACO-ARANHA: ...- Macaco-aranha. Ateles geoffroyi. Lúcia Helena Salvetti De Cicco. ... SUBFAMÃ?LIA: Atelinae NOME CIENTIFICO: Ateles geoffroyi NOME EM INGLES: Spider Monkeys. ... http://www.damisela.com/zoo/mam/primates/cebidae/geoffroyi/ Atelo Geoffroi: ...- Atelo Geoffroi. Ateles geoffroyi. ... http://www.damisela.com/zoo/mam/primates/cebidae/geoffroyi/taxa.htm Ateles geoffroyi: ...- Atelo Geoffroi. Ateles geoffroyi. TaxonomÃa. El Atelo Geoffroi ( Ateles geoffroyi ) fue presentado a la ciencia por Kuhl en 1820. ... http://members.tripod.com/uakari/ateles_geoffroyi.html Black-handed Spider Monkey (Ateles geoffroyi): Black-handed Spider Monkey (Ateles geoffroyi). MORPHOLOGY: The black-handed spider monkey has a prehensile tail which it uses for ... http://members.tripod.com/cacajao/ateles_links.html Ateles Links: ...in Spanish) Parco Zoo Falconara: Ateles fusciceps (Brown-headed Spider Monkey) (in Italian) (note map is wrong) Oakland Zoo: Ateles geoffroyi (Black-handed ... http://www.primatesofpanama.org/academicresources/articles/spiderblack.htm Natural history of the Black-handed Spider Monkey (Ateles ...: Natural History of the Black-handed Spider Monkey (Ateles geoffroyi). ... Countries of existence. The habitat of Ateles geoffroyi ranges from Mexico to Panama. ... http://www.primatesofpanama.org/academicresources/articles/monoculture/primateoverview.htm Primates: X. LR. Alouatta pigra. X. X. X. LR. Ateles. Ateles geoffroyi geoffroyi. X. CR. Ateles geoffroyi azuerensis. X. VU. Ateles geoffroyi frontatus. X. X. EN. ... http://spidermonkey.zoodoue.fr/2001-EAZA-Ateles-geoffroyi.htm Ateles-geoffroyi-studbook: Ateles geoffroyi. Compiled by: Pierre Gay. ... pgay@zoo-de-doue.com. Data current as of 31 December 2001. BLACK-HANDED BLACK SPIDER MONKEY Studbook(Ateles geoffroyi). ... http://spidermonkey.zoodoue.fr/Ateles-geoffroyi-geoffroyi.htm Ateles-geoffroyi-geoffroyi: Ateles geoffroyi geoffroyi. Vernacular names: Nicaraguan spider monkey, golden spider monkey. Physical characteristics Ag geoffroyi ... http://www.infocostarica.com/fauna/spmonkey.html Costa Rica - Spider Monkey: Spider Monkey (Ateles Geoffroyi) ... by Infocostarica Staff. ... There are nine subspecies of Ateles geoffroyi based upon variation in coat color. ... http://vogelstimmen.naturecom.de/lexikon/geoffroy-klammeraffe.html Geoffroy-Klammeraffe - Ateles geoffroyi: ...- Geoffroy-Klammeraffe - Ateles geoffroyi. Geoffroy-Klammeraffen leben in den dichten Urwäldern Brasiliens. Sie bewegen sich hauptsächlich ... http://www.apus.ru/site.xp/054050053124050051054054.html APUS.RU | ОбезьÑ?на чернорукаÑ? ...: ЧернорукаÑ? паукообразнаÑ? обезьÑ?на Джоффри - Ateles geoffroyi - один из четырех видов ... http://www.apus.ru/on_site.php?p1=693&p3=2193 APUS.RU | Страница не найдена: APUS.RU Страница не найдена. -AdRiver-. ПоиÑ?к. Страница не найдена, возможно она ... http://www.funet.fi/pub/sci/bio/life/mammalia/primates/cebidae/ateles/ Ateles: NE.Colombia - Mexico (Tamaulipas, Oaxaca, Jalisco?). See [About maps]. Ateles geoffroyi Kuhl, 1820 Ateles geoffroyi Kuhl, 1820; Beitr. Zool. Vergl. Anat. ... http://www.acguanacaste.ac.cr/rothschildia/v1n1/textos/06.html " La Comunicación Vocal en el Mono Araña (Ateles geoffroyi): la ...: ...- "La Comunicación Vocal en el Mono Araña (Ateles geoffroyi): la función y el significado de sus llamadas". Patricia Teixidor Monsell ... http://www.earthscape.org/p1/bri04/bri04.html Natural History of the Black-Handed Spider Monkey (Ateles ...: EARTHSCAPE DATE: 09/02. Natural History of the Black-Handed Spider Monkey (Ateles geoffroyi). ... The habitat of Ateles geoffroyi ranges from Mexico to Panama. ... http://www.primatesmx.com/Ateles.htm Ahumada J: Congr. Primat., Zurich 3 32-40. Eisenberg, JF 1973 Reproduction in two species of spider monkeys, Ateles fusciceps and Ateles geoffroyi Mammalogy 54 4 955-957. ... http://1kai.dokkyomed.ac.jp/mammal/jp/species_all/ateles_geoffroyi.html Ateles geoffroyi: Ateles geoffroyi Black-handed Spider Monkey アカクモザル 分類. 目：Primates（Primates, 霊長目） 科：Cebidae（New ... http://1kai.dokkyomed.ac.jp/mammal/jp/species/ateles_geoffroyi.html アカクモザル: Ateles geoffroyi Black-handed Spider Monkey アカクモザル 分 é¡ž. 目：Primates （Primates, 霊長目） 科：Cebidae（New ... http://www.dyrebrevkassen.dk/html/leksikon/76t.html Edderkopabe, gylden - Dyrebrevkassen: Edderkopabe, gylden Latinsk navn: Ateles geoffroyi. Gylden edderkopabe lever i tropisk regnskov i Mellemamerika. Gylden edderkopabe ... http://ecos.fws.gov/SpeciesProfile?spcode=A01T Species Profile for Spider monkey: Link to FWS Home Page. Monkey, spider Ateles geoffroyi frontatus Family: Cebidae Group: Mammals Current Status: Endangered (see below). ... http://www.ipbir.org/ipbir_cgi/tax.cgi?mode=2&id=2&lvl=1 IPBIR: Integrated Primate Biomaterials and Information Resource ...: ...born. PR00133, Ateles geoffroyi, black-handed spider monkey, Tissue Skin, not available, Female, born in captivity. PR00170, Ateles geoffroyi, ... http://merops.sanger.ac.uk/speccards/peptidase/sp000173.htm Peptidase of Ateles geoffroyi (black-handed spider monkey): Ateles geoffroyi (black-handed spider monkey). TAXONOMY. Taxonomy database identifier: 9509. Superkingdom, Eukaryota. Kingdom, Animalia. Subkingdom, Metazoa. ... http://www.jjphoto.dk/animal_archive/ateles_geoffroyi.htm Ateles geoffroyi: ...<< Back to PHOTOGRAPHIC LIBRARY, ATELES GEOFFROYI, Family: Cebidae, Order: Primates, Class: Mammalia. JOHNNY JENSEN's PHOTOGRAPHIC LIBRARY. ... http://www.lrz-muenchen.de/~kld3102/webserver/webdata/skelet/SAtelgeo.htm Sektion Primatologie: Ateles geoffroyi: ...- Neuaufnahme der Skelete 2001 / Reinventory of Skeletons 2001 Species: Ateles geoffroyi (v. Hasselt & Kuhl, 1820). Bearbeiter/Revisor: Dr. Dr. Olav Röhrer-Ertl. ... http://www.lrz-muenchen.de/~kld3102/webserver/webdata/reinventory/Atelgeof.htm Sektion Primatologie: Ateles geoffroyi: ...- Neuaufnahme der Schädel 2000 / Reinventory of crania 2000 Species: Ateles geoffroyi (v.Hasselt & Kuhl, 1820). Bearbeiter/Revisor: Dr. Dr. Olav Röhrer-Ertl. ... http://www.junglewalk.com/video/Spider-Monkey-movie.asp Spider Monkey movie, Spider Monkey video, Spider Monkey posters: Spider Monkeys (Ateles geoffroyi) - sometimes the crown of a huge canopy tree is alive with primate splendor. ... Spider Monkeys (Ateles geoffroyi), ... http://www.redlist.org/search/details.php?species=43901 IUCN Red List of Threatened Species - Ateles geoffroyi ssp. ...: Ateles geoffroyi ssp. geoffroyi. Taxonomy. Kingdom, ANIMALIA. ... Citation: Primate Specialist Group 1996. Ateles geoffroyi ssp. geoffroyi. In: IUCN 2003. ... http://www.inrp.fr/Acces/Biogeo/evolut/primates/atge.htm Ateles geoffroyi: ...- ... Il vit dans les forêts du nord de l'Amérique latine au Brésil et à la Bolivie. Taille : 40 à 60 cm sans la queue. Singe araignée Ateles geoffroyi. ... http://www.primate.wisc.edu/pin/images/ateles.html WPRC Primate Image Collection: Mother with infant in lateral hip flexure Location: Barro Colorado Island, Panama Photographer: Roy Fontaine, Slide #000046 Ateles geoffroyi Mother forming ... http://www.primate.wisc.edu/pin/factsheets.html PIN: Fact Sheets: Black Spider Monkey) Singapore Zoological Gardens: Ateles fusciceps (Brown-headed Spider Monkey) All Creatures Great and Small: Ateles geoffroyi (Spider Monkeys ... http://artemida.amu.edu.pl/~ateles/galeria/ Ateles geoffroyi yucatanensis: Ateles geoffroyi yucatanensis. ZOO PoznaÅ„. G A L E R I A. >>> Zosia. >>> Kolombo. >>> Zuzia. ZdjÄ™cia z filmu VHS Operator kamery PaweÅ‚ ... http://www.sas.upenn.edu/~ramosfer/cv.html CURRICULUM VITAE: Ph.D. in Biology, 2001. Thesis: "Patterns of association, feeding competition and vocal communication in spider monkeys, Ateles geoffroyi". ... http://www.ingenta.com/isis/searching/ExpandTOC/ingenta?issue=pubinfobike://nrc/gen/2004/00000047/00000002&index=2 Ingenta: Article Summary -- Construction and characterization of ...: ...- ... Construction and characterization of bacterial artificial chromosome library of black-handed spider monkey (Ateles geoffroyi) Genome 1 April 2004, vol. 47, no. ... http://www.itec-edu.org/INSTRUCTORS/Campbell.html ITEC Faculty: Recent Publications. In Preparation. Campbell, CJ Copulatory behavior of free ranging black-handed spider monkeys (Ateles geoffroyi). ... http://www.anthropology.pomona.edu/html/faculty/ccampbell/ccampbellCV.htm PRESENT ADDRESS: Thesis Title: “The reproductive biology of black-handed spider monkeys (Ateles geoffroyi): Integrating behavior and endocrinologyâ€?. 1996. ... http://www.mindysmem.org/spider.html Mindy's Memory - Spider Monkey Facts: Anaya-Heuertas C; Mondragon-Ceballos R Social behavior of black-handed spider monkeys (Ateles geoffroyi) reared as home pets. INTERNATIONAL ... http://uts.cc.utexas.edu/~adgordon/Postcrania.txt Taxon Museum Adult Wild Total Females Femur (F) Tibia (F) Humerus ...: ...robustus FMNH Yes Yes 0 0 0 0 0 0 0 0 0 0 1 1 1 1 1 Haplorhini Platyrrhini Ceboidea Atelidae Atelinae Ateles fusciceps robustus Ateles geoffroyi NMNH Yes Yes 1 ... http://www.omne-vivum.com/b/2991.htm genus Ateles- -: HOMEPAGE, Ateles. T" "Ateles geoffroyi species: Ateles geoffroyi. Mapping project, books about Ateles geoffroyi at Amazon, Search google for Ateles geoffroyi. ... http://www.icb.ufmg.br/~primatas/bdp_tsubspecies.htm Number fo Records by Family, Genus, Species and Subspecies: ...- ... Ateles belzebuth ? 1. Ateles chamek, 59. Ateles chamek, 59. Ateles geoffroyi, 106. Ateles geoffroyi ? 41. Ateles geoffroyi azuerensis, 1. Ateles geoffroyi frontatus, 3. ... http://www.icb.ufmg.br/~primatas/bdp_tsspuc.htm Number of Records by Conservation Unit (UC) Category and ...: ...- ... Alouatta pigra, 1. Ateles geoffroyi yucatanensis, 1. AI, 27. ... Juil (15 km a NE), 2. Alouatta pigra, 1. Ateles geoffroyi vellerosus, 1. Kaxinawá (R. Tarauacá), 1. ... http://www.markuskappeler.ch/tex/texs/klammeraffe.html Geoffroy-Klammeraffe: ...- Geoffroy-Klammeraffe - Ateles geoffroyi. © 1990 Markus Kappeler / Groth AG (erschienen in der WWF Conservation Stamp Collection, Groth AG, Unterägeri). ... http://www.origins.tv/darwin/zoo/newmonk.htm Zoology -- New World Monkeys: Af robustus -- Columbian Black Spider Monkey -- [ *dupc ] Ateles geoffroyi -- Black-handed Spider Monkey -- [ *wisc | *fsu | *acg | *dupc | *prsp | *vzoo ]: ... http://home.t-online.de/home/othmar.bahner/Primats/03.htm Die Ordnung der Primaten: Affen: ...- ... Braunkopf-Klammeraffe, Ateles fusciceps Gray, 1866. 3.1.1.39 Ateles geoffroyi. Geoffroy-Klammeraffe, Ateles geoffroyi Kuhl, 1820. 3.1.1.40 Lagothrix. ... http://www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=Ateles+geoffroyi+%5Bgbpri%5D Codon usage table: Ateles geoffroyi [gbpri]: 11 CDS's (2175 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU 26.2( 57) UCU 11.0( 24 ... http://www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=mitochondrion+Ateles+geoffroyi+vellerosus+%5Bgbpri%5D Codon usage table: ...mitochondrion Ateles geoffroyi vellerosus [gbpri]: 4 CDS's (755 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU ... http://pubs.nrc-cnrc.gc.ca/cgi-bin/rp/rp2_abst_e?gen_g03-122_47_ns_nf_gen2-04 NRC Research Press: Genome: ...- ... Construction and characterization of bacterial artificial chromosome library of black-handed spider monkey (Ateles geoffroyi) Yaping Qian, Li Jin, and Bing Su ... http://www.infochembio.ethz.ch/links/zool_saeuget_affenneu.html Neuweltaffen: Säugetiere: Black-handed Spider Monkey (Ateles geoffroyi) - Text and Image. Black-handed Spider Monkey (Ateles geoffroyi) - Text and Images. ... http://www.imp-muenchen.de/List_of_publications.300.1.html IMP-München: List of publications: M.; CARRERA SANCHEZ, E.; RODRIGUEZ RIVERA, JA; RODRIGUEZ LUNA, E. (1996): Gustatory thresholds for food-associated sugars in the spider monkey (Ateles geoffroyi ... http://mind-brain.com/abstracts.php?qa=reproductive REPRODUCTIVE: ...were analyzed for patterns associated Patterns of behavior across reproductive states of free-ranging female black-handed spider monkeys (Ateles geoffroyi). ... http://www.directory.co.uk/Spider_Monkey.htm Spider Monkey in directory.co.uk: Ateles geoffroyi. ... 13. Peptidases of Ateles geoffroyi (black-handed spider monkey) Ateles geoffroyi (black-handed spider monkey) Page created 21-Mar-2001. ... http://www.brown.edu/Research/Primate/lpn40-4.html Laboratory Primate Newsletter, Volume 40, Number 4: ...*. Behavioral Differences Between Sexes in Captive Spider Monkeys (Ateles geoffroyi). ... The behavior of Ateles geoffroyi and related species. ... http://www.equipemacacoaranha.hpg.ig.com.br/macacoaranha.htm Macaco-aranha: ...- Macaco-aranha. Ateles geoffroyi. NOME VULGAR: Macaco-aranha FILO: Chordata CLASSE: Mammalia ORDEM: Primatas FAMILIA: Cebidae SUBFAMÃ?LIA ... http://www.statemuseum.arizona.edu/zooarch/hierarchy.asp?tl=Genus_sp&tx=Ateles%20geoffroyi Browse Hierarchically - Comparative Vertebrate Collections ...: The Stanley J. Olsen and WACC Comparative Vertebrate Collections. Holdings for: Ateles geoffroyi - spider monkey. Specimen #, Sex, Age, Cranium, Postcrania. ... http://content.karger.com/ProdukteDB/produkte.asp?Aktion=ShowFulltext&ProduktNr=223842&Ausgabe=225020&ArtikelNr=21676 Karger Publishers: Habitat Use, Population Density and Subgrouping Pattern of the Yucatan Spider Monkey (Ateles geoffroyi yucatanensis) in Quintana Roo, Mexico Juan Pedro Gonzalez ... http://jeb.biologists.org/cgi/content/abstract/207/14/2465 JEB -- Summaries: Riba-Hernández et al. 207 (14): 2465: Effect of polymorphic colour vision for fruit detection in the spider monkey Ateles geoffroyi, and its implications for the maintenance of polymorphic colour ... http://perso.club-internet.fr/boudetjo/ZooList/Mammif/Dangprim.html Primates en danger: Colombia, IUCN : Vulnérable. Ateles geoffroyi, Singe-araignée de Panama à mains noires, Black-handed Spider Monkey. Kuhl, 1820. S Mexico to Panama. ... http://fwie.fw.vt.edu/wcs/051080.HTM Spider monkey: NAME - Spider monkey FAMILY - Cebidae SCIENTIFIC NAME - Ateles geoffroyi REFERENCES - 2 and 3 National abundance, Conservation or Economic Status Reference ... http://home.globalcrossing.net/~brendel/primate.html PRIMATES (prosimians, monkeys, apes and humans): Ateles fusciceps (brown-headed spider monkey). Ateles geoffroyi (black-handed spider monkey). Ateles paniscus (black spider monkey). Genus Brachyteles. ... http://uio.mbl.edu/SOAPbrowser/index.php?func=vLang&code=fre&package=4&page=0 TNS Browser: ...- ... Geoffroy, 1806). Atèle à tête brune, Ateles geoffroyi fusciceps. ... Geoffroy, 1806. Atèle de geoffroy du panama, Ateles geoffroyi panamensis. ... http://www.mos.gov.pl/cites-ma/gat_I_II.html zal_I_II: Alouatta palliata, Alouatta pigra =308, Ateles geoffroyi frontatus, Ateles geoffroyi panamensis, Brachyteles arachnoides, Cacajao spp. Chiropotes albinasus, ... http://www.aesop-project.org/Primate_Trade/CITES_Appendices.htm CITES Appendix I Primate Species: Scientific Name - Appendix I species. Common Name. Effective. Ateles geoffroyi panamensis. ... (7/1/75). Ateles geoffroyi frontatus. Black-handed spider monkey. (7/1/75). ... http://www.asp.org/asp2003/showTaxonomicIndex.cfm Conference Schedule: ...[135]. Ateles [65] [150] [155]. Ateles geoffroyi [46] [67] [203] [204] [205]. Ateles geoffroyi yucatanensis [60]. Balanites wilsoniana [99]. Bambusa sp. [19]. ... http://www.asp.org/asp2004/showTaxonomicIndex.cfm Conference Schedule: Aotus sp. [21]. Ateles geoffroyi [77] [80] [81] [85] [102]. Ateles geoffroyi yucatanensis [84]. Bactris gasipaes [46]. Brachyteles hypoxanthus [159]. ... http://www.primates.com/classification/ Living Primates: ...spider monkey; (Ateles geoffroyi) Black-handed spider monkey; (Ateles paniscus) Black spider monkey. Brachyteles: (Brachyteles arachnoides ... http://156.99.114.200/abstracts/Abs70259.asp ISIS Abstracts: Ateles geoffroyi Black-handed spider monkey. Range: CENTRAL MEXICO-VENEZUELA. ... Totals, 103, 209, 21, 6. Ateles geoffroyi <<< Group >>> Black-handed spider monkey. ... http://www.floranimal.ru/pages/animal/o/448.html ОБЕЗЬЯÐ?Ð? ПÐ?УКООБРÐ?ЗÐ?Ð?Я ЧЕРÐ?ОРУКÐ?Я: ОБЕЗЬЯÐ?Ð? ПÐ?УКООБРÐ?ЗÐ?Ð?Я ЧЕРÐ?ОРУКÐ?Я (Ateles geoffroyi). Млекопитающие / Приматы ... http://www.zoothailand.org/animals/cites/appendices_I-II.html CITES Appendices: ...- ... Alouatta coibensis =307. Alouatta palliata. Alouatta pigra =308. Ateles geoffroyi frontatus. Ateles geoffroyi panamensis. Brachyteles arachnoides. Cacajao spp. ... http://www.facultyof1000.com/pubmed/12576131 Successful acquisition of an olfactory discrimination paradigm by ...: Click here to read Successful acquisition of an olfactory discrimination paradigm by spider monkeys, Ateles geoffroyi. Laska M, Salazar LT, Luna ER. ... http://www.caribbeangardens.com/Plants_Animals/Animals.htm Animals at the Caribbean Gardens: Monkey, black-handed spider, Ateles geoffroyi. Monkey, patas, Erythrocebus patas. ... Spider monkey, black handed, Ateles geoffroyi. Tiger, Panthera tigris. ... http://www.nearctica.com/conserve/internat/citesa2.htm Nearctica - Conservation - Endangered Species - Cites Appendices I ...: 305 Saguinus bicolor Saguinus geoffroyi =306 Saguinus leucopus Saguinus oedipus Cebidae Alouatta palliata Alouatta pigra =307 Ateles geoffroyi frontatus Ateles ... http://www.brenda.uni-koeln.de/sequences/seq_tsv_EC_download.php4?ec=1.9.&type=fasta Q01519 | cytochrome-c oxidase | 1.9.3.1 | Saccharomyces cerevisiae ...: QAMLASMRPGLFYGQCSEICGSNHSFMPIVLEFIYFQDFEVWASYLYIVSL >Q9G1E0 | cytochrome-c oxidase | 1.9.3.1 | Ateles geoffroyi panamensis | TREMBL ... http://www.highbeam.com/library/search.asp?FN=AO&refid=ency_refd&search_almanacs=on&refid=ency_refd&q=sea%20AND%20spider HighBeam Research: eLibrary Search: Results: Southeastern US, Caribbean Sea, S America Monkey, spider Ateles geoffroyi frontatus ... ... Sea, S America Monkey, spider Ateles geoffroyi ... ... http://www.highbeam.com/library/search.asp?FN=AO&refid=ency_refd&search_almanacs=on&refid=ency_refd&q=ocelot HighBeam Research: eLibrary Search: Results: ...manatus Southeastern US, Caribbean Sea, S America Monkey, spider Ateles geoffroyi frontatus Costa Rica, Nicaragua Ocelot Felis pardalis US (AZ, TX) to Central ... http://www.heynkes.de/gelesen/aeid.htm Science 1977 Sep 2; 197(4307): 943-60: ...- ... 13 Monate), 1 Geoffroy-Klammeraffen (Ateles geoffroyi, Spider monkey) (Inkubationszeit 24 Monate), 2 Kapuzineraffen (Unterfamilie Cebinae, capuchin ... http://www.mad-cow.org/~tom/dna_seqs.html Prion ORF DNA: Aotus trivirgatus Armenian hamster Ateles geoffroyi Ateles paniscus Bos taurus C.hircus Callicebus moloch Callithrix jacchus Camelus dromedarius Cebus apella ... http://arxiv.org/abs/physics/0301019 [physics/0301019] Levy walk patterns in the foraging movements of ...: 58:15 GMT (91kb) Levy walk patterns in the foraging movements of spider monkeys (Ateles geoffroyi). Authors: Gabriel Ramos-Fernandez ... http://www.meitetsu.co.jp/japan-monkeycentre/primates/41/41-2.html Vol.41-2: Hernandes; Luna, Ernesto Rodriguez; Hudson, Robyn: Gustatory Responsiveness to Food-associated Acids in the Spider Monkey (Ateles geoffroyi)....213 Key ... http://medicine.ucsd.edu/cpa/mon.html Comparative Placentation: Campbell, CJ, Shideler, SE, Todd, HE and Lasley, BL: Fecal analysis of ovarian cycles in female black-handed spider monkeys (Ateles geoffroyi). Amer. ... http://www.sa-zoo.org/02meet/02sublinks/spidmonk.html [an error occurred while processing this directive] Ateles geoffroyi [an error occurred while processing this directive] 2279 Black-Handed Spider Monkey, Central American Spider Monkey, Geoffroy's Spider Monkey, Mono Colorado, Atèle De Geoffroy, Mico, Mono Araña Black-Handed Spider Monkey, Central American Spider Monkey, Geoffroy's Spider Monkey, Mono Colorado, Atèle De Geoffroy, Mico, Mono Araña Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |