|
|
Bothrops pirajai - Piraja's LanceheadIUCN Status: VulnerableIUCN Species Profile http://scop.berkeley.edu/data/scop.b.b.bhd.b.b.html SCOP: Family: Vertebrate phospholipase A2: Bothrops pirajai, Piratoxin-II (PRTX-II) [48633] (1) pic pic; Russell's viper (Vipera russelli) [48634] (1) pic pic anticoagulant class II phospholipase A2; ... http://www.ib.unicamp.br/institucional/ib/abstracta/1999/periodicos/001_009.html Abstracta 1999 Publicados em Periódicos-IB Unicamp: P004-99 Crystallization and preliminary X-ray diffraction studies of piratoxin III, a D-49 phospholipase A(2) from the venom of Bothrops pirajai. ... http://www.ib.unicamp.br/institucional/ib/abstracta/2000/periodicos/050_059.html Abstracta-IB: M, Giglio JR, Marangoni S*, De Nucci G, Antunes E Piratoxin-I (PrTX-I) is a Lys-49 phospholipase (PLA(2)) homologue, isolated from Bothrops pirajai snake venom ... http://www.snakeman1982.com/ListBothrops.asp JADIN EXPEDITIONS: Bothrops neuwiedi urutu. Bothrops pictus Desert Lancehead. Bothrops pirajai Piraja's Lancehead. Bothrops sanctaecrucis Bolivian Lancehead. ... http://www.geocities.com/tassonomia2/viperidae.htm Viperidae: Bothrops ophryomegas. Bothropsophryomegas1.jpg (81204 byte). Bothrops pictus. Bothrops pirajai. Bothrops prodoi. Bothrops pulcher. Bothrops roedingeri. ... http://www.humaterra.net/taxonomie/liste_ophidiens_venin.htm liste des serpents venimeux du monde - systématique humaterra: ...nasutus Bothrops neuwiedi Bothrops nigroviridis nigroviridis Bothrops nummifier Bothrops orphryomegas Bothrops peruvianis Bothrops pirajai Bothrops schlegelii ... http://animaldiversity.ummz.umich.edu/site/accounts/classification/Bothrops.html ADW: Bothrops: Classification: Species Bothrops pictus. Species Bothrops pirajai. Species Bothrops pradoi. Species Bothrops sanctaecrucis. Species Bothrops venezuelensis. ... http://l.autin.free.fr/Lee/lee.htm Document sans titre: ...collection, resolution, refinement and analysis of 3-dehydroquinase from Salmonella typhi and phospholipases A2 (piratoxin-II and III) from Bothrops pirajai. ... http://eco.ib.usp.br/labvert/Jararaca/projjar_filogenia.htm Hipótese filogenética para as espécies de jararacas: Bothrops moojeni. Bothrops pradoi. jararacussu. Bothrops brazili. Bothrops jararacussu. Bothrops pirajai. Bothrops sp. (Alagoas). Portuguese. English. ... http://eco.ib.usp.br/labvert/Jararaca/projjar_referencias_m.htm Letra(s) anterior(es): Fractionation of Bothrops pirajai snake venom: Isolation and characterization of piratoxin-I, a new myotoxic protein. Toxicon 33(5):615-626. ... http://scop.bic.nus.edu.sg/data/scop.b.b.bef.b.b.ba.html SCOP: Protein: Snake phospholipase A2 from <i>Bothrops pirajai</i> ...: Protein: Snake phospholipase A2 from Bothrops pirajai, Piratoxin-II (PRTX-II). Lineage: ... Species: Bothrops pirajai, Piratoxin-II (PRTX-II). PDB Entry Domains: ... http://scop.bic.nus.edu.sg/data/scop.b.b.bef.b.b.A.html SCOP: Family: Vertebrate phospholipase A2: 1) neurotoxic phospholipase a2: 2not seq: chain a; chain b. Bothrops pirajai, Piratoxin-II (PRTX-II) (1): 1qll seq complexed with tda: ... http://www.ingenta.com/isis/searching/ExpandTOC/ingenta?issue=pubinfobike://ben/ppl/2003/00000010/00000001&index=12 Ingenta: Article Summary -- Spectroscopic Analysis of the ...: ...induced by guanidine on Bothrops moojeni myotoxins-I (MjTX-I) and II (MjTX-II), Bothrops jararacussu bothropstoxin-I (BthTX-I) and Bothrops pirajai piratoxin-I ... http://www.ingenta.com/isis/searching/ExpandTOC/ingenta?issue=infobike://els/03009084/2003/00000085/00000010&index=10 Ingenta: Article Summary -- Inhibition of enzymatic and ...: The extract exhibited also full inhibition of hemorrhage caused by Bothrops alternatus, Bothrops moojeni and Bothrops pirajai snake venoms, but partial ... http://scripts.iucr.org/cgi-bin/similar?wordList=%22phospholipase%20a2%22%20or%20%22snake%20venoms%22&from=gr2103 (IUCr) Crystallography Journals Online - search results: The structure of the D49 phospholipase A 2 piratoxin III from Bothrops pirajai reveals unprecedented structural displacement of the calcium-binding loop ... http://www.gifte.de/bothrops-arten.htm Bothrops-Arten: ...- ... Bothrops pictus, Peru (entlang der pazifischen Küste). Bothrops pirajai, Brasilien (Bahia). ... Bothrops pictus, Desert lance head. Bothrops pirajai, Piraja's lance head. ... http://www.herpbreeder.com/worldspecies/Snakes/vipers/bothrops.htm Herpbreeder.dk: Distribution: Peru. Bothrops pictus (Tschudi, 1845) Distribution: Peru. Bothrops pirajai Amaral, 1923 Distribution: Brazil. Bothrops pulcher (Peters, 1862) ... http://www.scielo.br/scielo.php?script=sci_arttext&pid=S0104-79301998000200005&lng=es&nrm=iso Journal of Venomous Animals and Toxins - <b>POLYACRYLAMIDE GEL ...: Fractionation of Bothrops pirajai snake venom: isolation and characterization of piratoxin-I, a new myotoxic protein. Toxicon, 1995, 33, 615-26. [ Medline ]. ... http://www.scielo.br/scielo.php?script=sci_arttext&pid=S0100-879X1998000900004&lng=en&nrm=iso Brazilian Journal of Medical and Biological Research - <b>A single ...: Fractionation of Bothrops pirajai snake venom: isolation and characterization of piratoxin-1, a new myotoxic protein. Toxicon, 33: 615-626. [ Medline ]. ... http://ekhidna.biocenter.helsinki.fi:9801/pairsdb_lite/view_pdb_structure.txt?pid=1gmz&move=0.000,0.000,0.000,1.000,0.000,0.000,0.000,1.000,0.000,0.000,0.000,1.000 HEADER HYDROLASE 27-SEP-01 1GMZ TITLE CRYSTAL STRUCTURE OF THE D49 ...: HEADER HYDROLASE 27-SEP-01 1GMZ TITLE CRYSTAL STRUCTURE OF THE D49 PHOSPHOLIPASE A2 PIRATOXIN III TITLE 2 FROM BOTHROPS PIRAJAI. ... http://ekhidna.biocenter.helsinki.fi:9801/pairsdb_lite/view_pdb_structure.txt?pid=1qll&move=2.238,-0.861,55.479,0.337,-0.522,0.783,0.290,0.849,0.442,-0.896,0.079,0.437 HEADER NEUROTOXIN 01-SEP-99 1QLL TITLE PIRATOXIN-II (PRTX-II) - A ...: HEADER NEUROTOXIN 01-SEP-99 1QLL TITLE PIRATOXIN-II (PRTX-II) - A K49 PLA2 FROM BOTHROPS PIRAJAI COMPND MOL_ID: 1; COMPND 2 MOLECULE: PHOSPHOLIPASE A2; COMPND ... http://www.seitenwinder.de/rubriken/tipps/giftschlangenliste/listelatein.htm seitenwinder.de: Bothrops peruvianis. Peruvian pit viper. Bothrops pirajai. Piraja's pit viper, Jararacucu. Bothrops schlegelii. Greifschwanzpalmenlanzenotter. Eyelash viper. ... http://medlem.spray.se/extinction/ Hem till albumet: Anisolepis undulatus Tree Lizard VU. Bothrops pirajai Piraja's Lancehead VU. Hydromedusa maximiliani Brazilian Snake-necked Turtle VU. ... http://www.custodio-serpentes.dk/artsliste/viperidae.htm Viperidae: Bothrops moojeni, Bothrops neuwiedi, Bothrops pictus, Bothrops pirajai, Bothrops pradoi, Bothrops pulcher, Bothrops sanctaecrucis, Bothrops venezuelensis, ... http://www.biocristalografia.df.ibilce.unesp.br/publications/abstracts/abstract13.html Crystal structure of piratoxin-I: A calcium-independent, myotoxic ...: Crystal structure of piratoxin-I: A calcium-independent, myotoxic phospholipase A(2)-homologue from Bothrops pirajai venom De Azevedo WF, Ward RJ, Canduri F ... http://www.biocristalografia.df.ibilce.unesp.br/all_pub.php Laboratory of Biomolecular Systems: 1998. 13) Crystal structure of Piratoxin Ia Calcium-Independent Phospholipase-like Myotoxic Protein from Bothrops Pirajai Venom. ... http://www.bentham.org/ppl/ppl8-3.htm PPL 8-3: Venoms from Bothrops jararcussu Bothrops asper Bothrops atrox Bothrops pirajai Bothrops moojeni Bothrops alternatus and Bothrops (Bothriopasis) bilineata were ... http://www.epub.org.br/bjms/hofling/producao.htm Profa. Dra. Maria Alice da Cruz-Hofling: ...- ... Costa, PD; Toyama, MH; Marangoni, L.; Rodrigues-Simioni, L. & Cruz-Höfling, MA Effects of Bothrops pirajai on the mouse extensor digitorum longus (EDL) muscle ... http://www.epub.org.br/bjms/hofling/participacao.htm Profa. Dra. Maria Alice da Cruz-Hofling: ...- ... Título: “Ação do veneno total de Bothrops pirajai e de suas frações miotóxicas Piratoxinas Ie III sobre a musculatura esquelética: estudos in vitro ... http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Display&db=PubMed&dopt=pubmed_pubmed&from_uid=12079495 Entrez PubMed: Abstract, Crystal structure of piratoxin-I: a calcium-independent, myotoxic phospholipase A2-homologue from Bothrops pirajai venom. Toxicon. ... http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Display&db=PubMed&dopt=pubmed_pubmed&from_uid=15147240 Entrez PubMed: Abstract, Amino acid sequence of piratoxin-II, a myotoxic lys49 phospholipase A(2) homologue from Bothrops pirajai venom. Biochimie. 2000 Mar;82(3):245-50. ... http://metallo.scripps.edu/analysis/newpdb/recent_pdb.20020405.html Recent PDB releases or updates: week of 5 April 2002: 1gmz.pdb. hydrolase 27-sep-01 1gmz Title: crystal structure of the d49 phospholipase a2 piratoxin iii from bothrops pirajai. Author ... http://www.biochem.ucl.ac.uk/bsm/pdbsum/1qll/main.html PDB 1qll: Title: Piratoxin-ii (prtx-ii) - a k49 pla2 from bothrops pirajai. ... Other_details: fatty acid trapped at the hydrophobic channel Source: Bothrops pirajai. ... http://www.biochem.ucl.ac.uk/bsm/pdbsum/1gmz/main.html PDB 1gmz: Hydrolase. Title: Crystal structure of the d49 phospholipase a2 piratoxin iii from bothrops pirajai. ... Chain: a, b. Ec: 3.1.1.4 Source: Bothrops pirajai. Snake. ... http://www.pick-upau.com.br/mundo/animais_em_extincao/repteis.htm repteis: ...- ... SP. Bothrops pirajai (Amaral, 1923) Nome popular: Jararaca Categoria de ameaça: Em perigo UF: BA › Testudines / Chelidae. Phrynops ... http://www.ufscar.br/~lfbbm/public.htm PUBLICAÇÕES: LC, Correa, MM, Vieira, CA, Cunha, OAB, Lachat, JJ., Selistre de Araujo, HS, Ownby, CL and Giglio, JR (1995) Fractionation of Bothrops pirajai snake venom ... http://www.lnls.br/org/rel_jan_jun2000/art1.htm Artigos Publicados em Periódicos Indexados: ...de pesquisadores do quadro próprio do LNLS 1. Amino acid sequence of piratoxin-II, a myotoxic Lys49 phospholipase A 2 homologue from Bothrops pirajai venom. ... http://pauling.mbu.iisc.ernet.in/~pali/members.cgi?famno=scop.b.b.bgf.b.b Vertebrate phospholipase A2: Protein:Phospholipase A2 Species:Human (Homo sapiens), SPLA2 Domain:1gmza_ from Protein:Snake phospholipase A2 Species:Snake (Bothrops pirajai), piratoxin III ... http://www.biodiversitas.org.br/biodiversidade_numeros.htm Fundação Biodiversitas: ...- ... robustus) Besouro-rola-bosta (Dichotomius schiffleri) Cobra Dormideira-queimada-grande (Dipsas albifrons cavalheiroi) Jararaca (Bothrops pirajai) Guigó, sauá ... http://www.biodiversitas.org.br/f_ameaca/frmteste4.asp Lista da Fauna Brasileira Ameaçada de Extinção: ...- ... pesquisar. Após aparecer os resultados, clique nos links para mais informações. Nome científico: http://scilib.univ.kiev.ua/author.php?744137 Сервер періодичних видань::Каталог ...: GIGLIO, LC MANCUSO, AM SOARES, RJ WARD, CRYSTALLIZATION OF PIRATOXIN-I, A MYOTOXIC LYS49-PHOSPHOLIPASE A(2) HOMOLOG ISOLATED FROM THE VENOM OF BOTHROPS PIRAJAI ... http://daisy.bio.nagoya-u.ac.jp/cgi-bin/het/String_het.cgi/path?IOH Hetero Atom Information: 1GMZ, Crystal structure of the d49 phospholipase a2 piratoxin iii from bothrops pirajai. : SOURCE MOL_ID: 1; bothrops pirajai; snake;. ... http://www.jvat.org.br/full/jvat_including_tropical_diseases/1997/number_1/l07-jvat_sbtx_poster_26.htm L07-Inflammatory effects induced by piratoxin-I, a PLA2 homologue ...: Campinas, SP, Brazil. Piratoxin-I (SP-5; 15.5 kDa) is a myotoxic Lys-49 PLA2 isolated from Bothrops pirajai snake venom. SP-5 is ... http://www.jvat.org.br/full/jvat_including_tropical_diseases/1997/number_1/l20-jvat_sbtx_poster_39.htm L20-Screening of the hemorrhagic, clotting and phospholipase A2 ...: Gel filtration of Bothrops jararacussu and Bothrops pirajai on Sephadex G-75, pH 8.0, and of Bothrops moojeni on CM-Sepharose, pH 7.0, afforded several ... http://www.sitecurupira.com.br/animais_ameacados/grupo_reptil.htm Nova pagina 1: ...- ... Bothrops pirajai (Amaral, 1923) Nome popular: Jararaca Categoria de ameaça: Em perigo UF: BA. Testudines. Chelidae. Vive em locais de clima quente. ... http://asparagin.cenargen.embrapa.br/publications/ Embrapa - Genetic Resources and Biotechnology - Bioinformatics ...: DJ, Hwa, LW, Marangoni, S., Toyama, MH, Polikarpov, I. The structure of the D49 phospholipase A2 piratoxin III from Bothrops pirajai reveals unprecedented ... http://www.mma.gov.br/port/sbf/fauna/popu7j.html Lista Nacional das Espécies da Fauna Brasileira Ameaçadas de ...: ...- ... Criticamente em perigo UF: SP. Bothrops pirajai (Amaral, 1923) Nome popular: Jararaca Categoria de ameaça: Em perigo UF: BA. A - B - C - D ... http://www.mma.gov.br/port/sbf/fauna/fam7v1.html Lista Nacional das Espécies da Fauna Brasileira Ameaçadas de ...: ...- ... ameaça: Criticamente em perigo UF: SP. Bothrops pirajai (Amaral, 1923) Nome popular: Jararaca Categoria de ameaça: Em perigo UF: BA. http://www.iesb.org.br/publicacoes/Agora%20Meio%20Ambiente%2010/trabalhos.htm Espaço Protegido: ...- ... registradas pode-se incluir o primata Leonthopithecus chrysomelas (mico-leão-da-cara-dourada), o roedor Echimys pictus, a serpente Bothrops pirajai, o louva-a ... http://www.vency.com/NATURALPOISONS.html NATURALPOISONS: Piratoxin-I, Snake Bothrops pirajai, Azevedo et al., 1998, Toxicon 36, 1395-1406. Polybitoxin, Wasp Polybia paulista, DeOliveira & Palma, 1998, Toxicon 36, 189-199. ... http://www.vency.com/VELENINATURALI.html NATURALPOISONS: Docs/P-700_852. Piratossina - I, Serpente Bothrops pirajai, Azevedo et al., 1998, Toxicon 36, 1395-1406. Polybitossina, Vespide Polybia ... http://www.kingsnake.com/toxinology/old/snakes/American/bothrops.html American Lance-headed pitvipers: Fractionation of Bothrops pirajai snake venom: isolation and characterization of piratoxin-I, a new myotoxic protein." Toxicon 33(5): 615-26. ... http://www.ciencia-hoy.retina.ar/hoy60/luz.htm Mas luz sobre los secretos: ...- ... Figura 7. Patrón de difracción típico de un cristal de proteína (en este caso, una fosfolipasa purificada a partir del veneno de la cobra Bothrops pirajai ... http://www.raintree.com.br/produtos/guacatonga_database.htm RAINTREE BRASIL: ...- ... de neutralizar a atividade hemorrágica causada pelos venenos de Bothrops asper, Bothrops jararacussu, Bothrops moojeni, Bothrops neuwiedi e Bothrops pirajai. ... http://msdlocal.ebi.ac.uk/docs/LOADID/LoadedID.10Feb03.html Latest PDB Load of Coordinate Entries: S.Tomaselli, R.Guerrini, S.Salvadori, AMD'Ursi, PA.Temussi, D.Picone, 1gmz, Crystal Structure of the D49 Phospholipase A2 Piratoxin III from Bothrops Pirajai. ... http://msdlocal.ebi.ac.uk/docs/LOADID/LoadedID.07Nov01.html Latest PDB Load of Coordinate Entries: Saludjian, A.Neuman, T.Prange. 1gmz. Crystal Structure of the D49 Phospholipase A2 Piratoxin III from Bothrops Pirajai. DJ.Rigden, LW.Hwa, I ... http://www.reptiltorget.com/ Reptiltorget (www.reptiltorget.com): ...leucurus Bothrops lojanus Bothrops marajoensis Bothrops microphthalmus Bothrops moojeni Bothrops neuwiedi Bothrops pictus Bothrops pirajai Bothrops pradoi ... http://genos.cnpq.br:12010/dwlattes/owa/prc_imp_cv_ext?f_cod=E10804 Currículo do Sistema de Currículos Lattes (Maria Alice da Cruz ...: ...- ... 49, COSTA, PD, TOYAMA, MH, MARANGONI, S., RODRIGUES-SIMIONI, L., CRUZ-HöFLING, MA Effects of Bothrops pirajai venom on the mouse extensor digitorum longus (EDL ... http://genos.cnpq.br:12010/dwlattes/owa/prc_imp_cv_int?f_cod=K4763233D8 Currículo do Sistema de Currículos Lattes (Igor Polikarpov) ...: ...- ... DJ, HWA, LW, MARANGONI, S, TOYAMA, MH, POLIKARPOV, Igor The structure of the D49 phospholipase A2 piratoxin III from Bothrops pirajai reveals unprecedented ... http://noticias.ro-noticias.com.br/ler_noticia.asp?IDNews=550 Informações em geral sobre o brasil: ...- ... Jacaré-do-papo-amarelo [Caiman latirostris] Harpia [Harpia harpyja] Entraram na lista: Macaco-prego [Cebus robustus] Jararaca [Bothrops pirajai] Veado-bororó ... http://journals.iucr.org/d/issues/1999/06/00/vj0015/vj0015bdy.html (IUCr) Crystallization and preliminary X-ray diffraction studies ...: Crystallization and preliminary X-ray diffraction studies of piratoxin III, a D-49 phospholipase A 2 from the venom of Bothrops pirajai. ... http://www.garfield.library.upenn.edu/histcomp/serum-phospholipase/index-lcs-2.html Outer References Missing Links? Journal list All-Author list ...: TOXICON 33(5):615-626 MANCUSO LC; CORREA MM; VIEIRA CA; CUNHA OAB; LACHAT JJ; DEARAUJO HSS; OWNBY CL; GIGLIO JR FRACTIONATION OF BOTHROPS-PIRAJAI SNAKE-VENOM ... http://elsevier.lib.sjtu.edu.cn/cgi-bin/sciserv.pl?collection=journals&journal=00039861&issue=v387i0002 Archives of Biochemistry and Biophysics, Volume: 387, Issue: 2 ...: Dissociation of Enzymatic and Pharmacological Properties of Piratoxins-I and -III, Two Myotoxic Phospholipases A 2 from Bothrops pirajai Snake Venom. ... http://www.cogeb.ufu.br/professores/cur_homs.htm Maria Inês Homsi Brandeburgo: ...- ... A simplified procedure for the partial purification of bothropstoxins and piratoxins from Bothrops jararacussu and Bothrops pirajai venoms. ... http://mips.gsf.de/cgi-bin/proj/sputnik/hydra/PEPTIDE/peptide_viewer.py?accession=C_BP509271 Sputnik3.0 EST and sequence cluster analysis system: ...match_accession, match_description, match_expect. gi|10835911|pdb|1QLL|A, Chain B, Piratoxin-Ii (Prtx-Ii) - A K49 Pla2 From Bothrops Pirajai, 0.075. interpro, ... http://bighost.area.ba.cnr.it/srs6bin/wgetz?%5Btaxonomy-ParentId:8721%5D+-e TAXONOMY:8722 ID : 8722 PARENT ID : 8721 RANK : species GC ID : 1 ...: Bothrops taeniatus // TAXONOMY:113192 ID : 113192 PARENT ID : 8721 RANK : species GC ID : 1 MGC ID : 2 SCIENTIFIC NAME : Bothrops pirajai // TAXONOMY:133440 ID ... http://www.unicamp.br/anuario/99/ib-db-p-012S0.html Anuario de Pesquisa Unicamp 1999 0703000000: ...[83526]; PD Costa, Maria Alice Cruz-hofling, L. Rodrigues-simioni, Sérgio Marangoni e MH Toyama, "Effects of Bothrops pirajai venom on the mouse extensor ... http://www.unicamp.br/sipex/projetosFapesp/Carga_2/RelatorioProjetosCargaFapesp.1999.U07030000000000.D20020517H171932.html Relatórios Carga Fapesp: ...- ... Nome Projeto: CARACTERIZACAO DA MIOTOXINA BASICA (PRTX-III) ISOLADA DE VENENO TOTAL DE BOTHROPS PIRAJAI: AVALIACAO ESTRUTURA-FUNCAO E ESTUDOS CRISTALIGRAFICOS. ... http://invention.swmed.edu/frisc/faculty/ordway/profile.shtml FRISC > Faculty Profiles > George A. Ordway, Ph.D.: 16. Score: 0.47. Effects of Bothrops pirajai venom on the mouse extensor digitorum longus (EDL) muscle preparation. PD Costa ... ... http://www.biof.ufrj.br/sbbf/conesul/abstracts/abs_e.html E - Structure and Dynamics of Proteins and DNA :: Here we describe the crystal structure of one such Lys49 PLA2, Piratoxin-II from the venom of Bothrops pirajai, in which a fatty acid molecule is observed to ... http://astral.berkeley.edu/asteroids-1.65/sequences/sf/a.133.1.fa d1poa__ a.133.1.2 (-) Snake phospholipase A2 {Taiwan cobra (Naja ...: ...spkmsaydyycgengpycrnikkkclrfvcdcdveaafcfakapynnanwnidtkkrcq >d1qlla_ a.133.1.2 (A:) Snake phospholipase A2 {Bothrops pirajai, Piratoxin-II (PRTX-II ... http://360graus.terra.com.br/bodyboard/news.asp?did=7212 www.360graus.com.br - Répteis: ...- ... perigo UF: SP Bothrops insularis (Amaral, 1922) Nome popular: Jararaca-ilhoa Categoria de ameaça: Criticamente em perigo UF: SP Bothrops pirajai (Amaral, 1923 ... http://www.biochemj.org/bj/362/0089/bj3620089.htm Biochem. J. (2002) 362, 89-96 - RJ Ward and others - Active-site ...: Control experiments were performed using piratoxin III, a catalytically active Asp 49 -PLA 2 purified from the venom of Bothrops pirajai under identical assay ... http://taxon.molgen.mpg.de/gettaxon?taxid=8721 TAXON Query Form: TaxID 106598, info); species: Bothrops pirajai (TaxID 113192, info); species: Bothrops pictus (TaxID 133440, info); species: Bothrops ... http://taxon.molgen.mpg.de/gettaxon?taxid=8710 TAXON Query Form: 106597, info); species: Bothrops taeniatus (TaxID 106598, info); species: Bothrops pirajai (TaxID 113192, info); species: Bothrops ... http://www.jbc.org/cgi/content/full/278/42/41400 JBC -- Liu et al. 278 (42): 41400: ...of acutohaemolysin with that of piratoxin II, a catalytically active Lys 49 PLA2 complexed with a 13-carbon fatty acid molecule from Bothrops pirajai venom (9 ... http://www.sosfauna.org/ameac.htm sos fauna: ...- ... SP. Bothrops pirajai Amaral, 1923 - Nome popular: Jararaca - Categoria de ameaça: Em perigo - Estados: BA. Testudines. Chelidae. Phrynops ... http://www.freeweb.hu/hobbiallat/kigyo.htm A vilkág kígyói: Costa Rica Bothrops pictus (Tschudi, 1845) Szinonim név: Lachesis paicta Élőhely: Peru Bothrops pirajai (Amaral, 1923) Szinonim név: ---- Élőhely: D ... http://www.cbi.cnptia.embrapa.br/~paula/publicacoes.htm publicacoes.htm: Crystallization and preliminary X-ray diffraction studies of piratoxin II, a phospholipase A2 isolated from the venom of Bothrops pirajai. ... http://cubic.bioc.columbia.edu/services/nlprot/species.txt adeno-associated virus 2 aav2 antarctic bacterium ds2-3r abies ...: ...bothrops moojeni lance-headed viper caissaca bothrops neuwiedi pauloensis neuwied's lancehead bothrops pictus lance head bothrops pirajai piraja's lance head ... http://www.cnpq.br/gpesq2/garea2/apg208/reg_se/uf_sp/i_usp/g_1014/gp1014.htm QUIMICA DE PROTEINAS - USP: ...- ... ISOLAMENTO E CARACTERIZACAO QUIMICA E PARCIAL DE TOXINAS MIOTOXICAS DO VENE NO DE BOTHROPS PIRAJAI. TESE DE DOUTORADO DE AUTORIA ... http://www.il.iucr.org/iucr-top/journalsonline/d/issues/1998/06/02/isscontsbdy.html (IUCr) Contents for Acta Crystallographica Section D Vol. 54 Part ...: D54, 1437-1439. Crystallization and preliminary X-ray diffraction studies of piratoxin II, a phospholipase A 2 isolated from the venom of Bothrops pirajai. ... http://pqs.ebi.ac.uk/pqs-doc/macmol/1qll.mmol HEADER NEUROTOXIN 01-SEP-99 COMPND MOL_ID: 1; COMPND 2 MOLECULE ...: 1.4; COMPND 6 OTHER_DETAILS: FATTY ACID TRAPPED AT THE HYDROPHOBIC COMPND 7 CHANNEL SOURCE MOL_ID: 1; SOURCE 2 ORGANISM_SCIENTIFIC: BOTHROPS PIRAJAI; SOURCE 3 ... http://herplit.com/herplit/download/1586-1939.txt Reference Type Author Year Title Secondary Author Secondary Title ...: ...garbei n. sp.; Heterorhachis n. gen.; Heterorhachis poecilolepis n. sp.; Bothrops erythromelas n. sp.; Bothrops iglesiasi n. sp.; Bothrops pirajai n. sp ... http://prolina.df.ibilce.unesp.br/fernanda/node3.html [an error occurred while processing this directive] Bothrops pirajai [an error occurred while processing this directive] 39902 Piraja's Lancehead Piraja's Lancehead Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |