|
|
Damaliscus lunatus - Tsessebe, Damalisque, Hirola, Korrigum, Sassaby, TopiIUCN Status: Lower Risk/Conservation DependentIUCN Species Profile http://www.thefreedictionary.com/Damaliscus%20lunatus Damaliscus lunatus definition of Damaliscus lunatus. What is ...: Definition of Damaliscus lunatus in the Dictionary and Thesaurus. Damaliscus lunatus in Free online English dictionary, thesaurus ... http://www.thefreedictionary.com/Damaged Damaged definition of Damaged. What is Damaged? Meaning of Damaged ...: ...encyclopedia - dictionary home page, Dictionaries: General, Computing, Medical, Legal, Encyclopedia, Damaged. Word: Word. ... http://www.yourdictionary.net/Damaliscus_lunatus.html Damaliscus lunatus - Dictionary Definition: Dictionary Definitions, Dictionary Definition of Damaliscus lunatus. Click Here, The noun "Damaliscus lunatus" has 1 senses. ... http://www.yourdictionary.net/Damaliscus%20lunatus.html www.yourdictionary.net/Damaliscus%20lunatus.html: Similar pages[ More results from www.yourdictionary.net ] ITIS Standard Report Page: Damaliscus lunatusGo to Print Version, Damaliscus lunatus (Burchell, 1823) Taxonomic Serial No.: 625082. ... Species, Damaliscus lunatus (Burchell, 1823) -- topi, References, Expert(s): ... http://www.itis.usda.gov/servlet/SingleRpt/SingleRpt?search_topic=TSN&search_value=625082 ITIS 'Expert(s)' Search results for Peter Grubb: ...sassabies. Damaliscus hunteri (PL Sclater, 1889) -- valid -- hirola. Damaliscus lunatus (Burchell, 1823) -- valid -- topi. Damaliscus ... http://www.forestryimages.org/browse/subimages.cfm?sub=3561 topi: Damaliscus lunatus (Artiodactyla: Bovidae) - Forestry Images: ...topi, Wildlife: Mammals. Mammalia > Artiodactyla > Bovidae > Damaliscus lunatus jimela, Synonym(s): Tsessebe, Korrigum, Tiang. Your query produced 3 records. ... http://www.forestryimages.org/browse/detail.cfm?imgnum=0009163 topi, Bovidae: Damaliscus lunatus N/A - Forestry Images: ...topi, Bovidae: Damaliscus lunatus N/A Image Number: 0009163. Subject: topi. ... Damaliscus lunatus jimela. Photographer: Chuck Bargeron, The University of Georgia. ... http://www.ecotravel.co.za/Guides/Wildlife/Vertebrates/Mammals/Large/Tsessebe.htm The Tsessebe - Damaliscus lunatus of Southern Africa: A Guide to the: Tsessebe - Damaliscus lunatus. The Tsessebe may appear rather awkward, but it is probably the fastest of the southern ... http://damaliscus_lunatus.bluerider.com/wordsearch/damaliscus_lunatus damaliscus lunatus - BlueRider.com: ...damaliscus lunatus - listen | domain availability, Dictionary and Thesaurus entries for: damaliscus lunatus. Your search results... ... http://www.funet.fi/pub/sci/bio/life/mammalia/artiodactyla/bovidae/damaliscus/ Damaliscus: Damaliscus lunatus (Burchell, 1823) lunatus (Burchell, 1823); Travels in Interior of Southern Africa 2: 334, TL: South Africa, Mathlowing River, NE. ... http://www.gironet.nl/home/cdon/Antelop2.htm Antelopes 2: Antelopes Page 2 . Topi Damaliscus lunatus topi Masai Mara, Kenya. nr. 991. Tsessebe Damaliscus lunatus lunatus Moremi NP Botswana. nr. 017. ... http://www.sitegigs.nl/wildlifelands/Antelop2.htm Antelopes 2: Antelopes Page . Topi Damaliscus lunatus topi Masai Mara, Kenya. nr. 991. Tsessebe Damaliscus lunatus lunatus Moremi NP Botswana. nr. 017. ... http://www.jww.de/artikelbeitrag/artikelbeitrag_13500.html JAGEN WELTWEIT: Topi or Leierantilope <i>Damaliscus lunatus</i> ...: ...- Praxistipps, - Trense. Topi or Leierantilope Damaliscus lunatus (Burchell, 1823). English: Topi; French: Damalisque, Topi, Sassaby; Acholi ... http://www.vulkaner.no/n/africa/lyreantilope.html Our Beautiful World: Lyreantilopene, Damaliscus lunatus ...: VÃ¥r vidunderlige verden. Lyreantilopene © John H. Fields, http://www.meandmephoto.com/Africa/Pages/Animals.html Lyreantilopene, Damaliscus lunatus .... ... http://www.vulkaner.no/n/africa/antilope.html VÃ¥r vidunderlige verden: Antiloper: Damagaselle. Damaliscus lunatus jimela Topi. ... Thomsongasellen. Damaliscus lunatus Lyreantilope. Hippotragus equinus Roan Hesteantilope Roan-antilope. ... http://www.floranimal.ru/pages/animal/t/342.html ТОПИ: РодÑ?твенные виды: БОÐ?ТБОК; ХИРОЛÐ?. ТОПИ (Damaliscus lunatus). Млекопитающие / Парнокопытные ... http://www.tierseiten.com/paarhufer/paarhufersystematik.html Systematik der Paarhufer: ...- ... Unterart: Damaliscus dorcas dorcas (Eigentlicher Buntbock) Unterart: Damaliscus dorcas philippsi (Bleßbock) Art: Damaliscus lunatus (Leierantilope) Unterart ... http://www.krugerpark.co.za/search/_Damaliscus_Lunatus.html Kruger National Park | Accommodation, Maps, Safari, Tours, Camps ...: Kruger National Park safari | Accommodation, Maps, Safari, Tours, Camps, Bookings. Information on ' Damaliscus Lunatus'. 0 Record(s). ... http://www.krugerpark.co.za/africa_tsessebe.html Tsessebe: Latin Name : Damaliscus Lunatus Weight (Female) : 126 kg Weight (Male) : 140 kg Length (Female) : 170 cm Length (Male) : 170 cm Gestation Period : 10 months No ... http://www.csew.com/antelopetag/Professional%20Site/Prof%20Bio%20Facts/Topi/Topi.htm Topi: Topi, Damaliscus lunatus jimela & Coastal topi, Damaliscus lunatus topi. Legal Status: Both the topi and coastal topi are considered ... http://www.omne-vivum.com/b/3600.htm genus Damaliscus- - - Lierantilopen: ...- T" "Damaliscus lunatus species: Damaliscus lunatus. ... http://eo.wikipedia.org/wiki/Bovedoj Bovedoj - Vikipedio: Damalisko - Damaliscus specio : †damalisko mallarÄ?muzela - Damaliscus angustirostris specio : damalisko blua - Damaliscus lunatus subspecio : damalisko ... http://www.thebigletterlist.net/word/k-Korrigum.html Korrigum: Damaliscus lunatus korrigum Find an Outfitter by: Destination. ... Damalisque F, Hirola F, Korrigum F, Sassaby F, Topi F, Tsessebe E ... Damaliscus lunatus ssp. ... http://www.apus.ru/site.xp/053048057124050055054049124.html APUS.RU | Топи, или Ñ?аÑ?Ñ?аби: Топи, или Ñ?аÑ?Ñ?аби - Damaliscus lunatus - обитают в Ñ?ухих Ñ?аваннах по вÑ?ей Южной и Западной Ð?фрике ... http://medicine.ucsd.edu/cpa/topi.htm Comparative Placentation: Topi & Sassabies Damaliscus lunatus korrigum Order:Artiodactyla Family:Bovidae 1) General Zoological Data Topis belong to a group of antelopes with curved horns ... http://utne.nvg.org/g/bovidae.html SkrivarstuÃ¥: Fe (Bovidæ): Connochætes taurinus taurinus. Kommentar. Damaliscus lunatus (topi): Damaliscus lunatus jimela; Damaliscus lunatus korrigum (korrigum sassaby); ... http://www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=mitochondrion+Damaliscus+lunatus+%5Bgbmam%5D Codon usage table: ...mitochondrion Damaliscus lunatus [gbmam]: 1 CDS's (380 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU 21.1( 8 ... http://www.chez.com/monamiph/afsud94.htm Liste naturaliste afrique du sud 1994: ...- ... Alcelaphines: Damaliscus dorcas Pallas Blesbok Mlilwane, Golden gate, Willem pretorius, Suikerbosrand; Damaliscus lunatus Burchell ssp. ... http://www.nhm.org/research/mammals/holdings/ARTIODAC.HTM Mammal Collection Holdings - Order ARTIODACTYLA: ...taurinus Kenya 2 Connochaetes taurinus 2 Connochaetes Kenya Nairobi District Prov 1 Connochaetes Kenya 1 Damaliscus hunteri 1 Damaliscus lunatus Angola 2 ... http://www.photoxplore.com/pages/ET_Ungulates/CCBW-01014.htm CCBW-01014: CCBW-01014. Botswana (Okavango Delta), Tsessebe (Damaliscus lunatus). PhotoXplore.com - by Stefano & Francesca Crosio Stefano@PhotoXplore ... http://www.webkenya.com/eng/safari/wildlife.php?id=18&let=&park=&type=&choice=1&rownb=98&print=0 Webkenya - Wildlife in Kenya - Topi (Tiang) in all Kenya parks: Tiang topi" (Damaliscus lunatus tiang), ... English name: Tiang topi Kiswahili name: Nyamera French name: Damalisque Latin name: Damaliscus lunatus tiang. ... http://www.webkenya.com/eng/safari/wildlife.php?id=17&let=&park=&type=&choice=1&rownb=97&print=0 Webkenya - Wildlife in Kenya - Topi (Jimela) in all Kenya parks: Jimela topi" (Damaliscus lunatus jimela), ... English name: Jimela topi Kiswahili name: Nyamera French name: Damalisque Latin name: Damaliscus lunatus jimela. ... http://www.erhverv.toldskat.dk/obj.asp?o_id=152176&chk=200522 ToldSkat: Oryx, Hippotragus oryx. Tiang, Damalscus lunatus tiang. Topi, Damaliscus lunatus jimela. ... Bontebok, Damaliscus dorcas dorcas. Sassaby, Damaliscus lunatus lunatus. ... http://animaldiversity.ummz.umich.edu/site/accounts/pictures/Bovidae_0060.html ADW: Bovidae: Classification: Connochaetes taurinus. topi and tsessebe Damaliscus lunatus, topi and tsessebe Damaliscus lunatus, topi and tsessebe Damaliscus lunatus. topi ... http://animaldiversity.ummz.umich.edu/site/resources/christopher_jameson/index_0060.html ADW: Jameson, Christopher: ...crocuta. humpback grouper Cromileptes altivelis, topi and tsessebe Damaliscus lunatus, topi and tsessebe Damaliscus lunatus. balloonfish ... http://www.acapixus.dk/galleri/slides/60.htm AcaPixus - Index over analoge billeder: 36x24 / Hartebeest, Koanantilope (Alcelaphus buselaphus, Bovidae) Ngorongoro NP / Tanzania KOL5945 / 36x24 / Topi (Damaliscus lunatus, Bovidae) Ngorongoro NP ... http://www.acapixus.dk/galleri/slides/35.htm AcaPixus - Index over analoge billeder: Stribet gnu, Hvidskægget gnu (Connochaetes taurinus, Bovidae) Hwange NP / Zimbabwe KOL3482 / 36x24 / Topi, Tsessebe (Damaliscus lunatus, Bovidae) Okavango ... http://www.bartleby.com/61/15/T0271550.html topi 2. The American Heritage® Dictionary of the English Language ...: PRONUNCIATION: t p. NOUN: Inflected forms: pl. topi or to·pis A sassaby (Damaliscus lunatus subsp. topi) of eastern Africa having a glossy dark brown coat. ... http://www.naturalvisions.co.uk/cgi-bin/nvsite/nv.pl?advsearch=1&k=17047&tags_here Search Results: ADD. RESULTS: 7, Damaliscus lunatus, PAGE 1 OF 1, 1, XMAM_0030_0005SS. Topi at dawn. XMAM_0030_0006XX. Topi on termite mound. XMAM_0030_0011XX. Topi in Masai Mara. ... http://www.ingenta.com/isis/searching/ExpandTOC/ingenta?issue=pubinfobike://els/00063207/2004/00000117/00000001&index=11 Ingenta: Article Summary -- Rainfall and the decline of a rare ...: Rainfall and the decline of a rare antelope, the tsessebe (Damaliscus lunatus lunatus), in Kruger National Park, South Africa Biological Conservation May 2004 ... http://www.ingenta.com/isis/browsing/TOC/ingenta?issue=pubinfobike://els/00063207/2004/00000117/00000001 Ingenta: Table of Contents -- Biological Conservation, May 2004 ...: Rainfall and the decline of a rare antelope, the tsessebe (Damaliscus lunatus lunatus), in Kruger National Park, South Africa Dunham KM; Robertson EF; Grant CC ... http://www.infochembio.ethz.ch/links/zool_saeuget_antilope.html Antilopen: Säugetiere: Topi - Image. Topi (Damaliscus lunatus) - Text and Images. Topi, Tsessebe (Topi, Tsessebe) (University of Michigan) - Text and Images. Wasserbock - Abbildung. ... http://www.nature-reserve.co.za/search/_Damaliscus_Lunatus.html Southern Africa Nature Reserves | South Africa Game Reserve ...: South Africa nature reserves | Krugerpark | Addo Elephant Park | Marekele | Kgalagadi | Wilderness. Information on ' Damaliscus Lunatus'. 0 Record(s). ... http://www.biodiversityscience.org/priority_outcomes/west_africa/rl-togo-a.html Red List: Togo: Animalia: CHORDATA, MAMMALIA, ARTIODACTYLA, BOVIDAE, Damaliscus lunatus, Damalisque (F), Hirola (F), Korrigum (F), Sassaby (F), Topi (F), Tsessebe (E), ... http://www.bbc.co.uk/nature/wildfacts/factfiles/646.shtml BBC - Science & Nature - Wildfacts - Topi: Topi Damaliscus lunatus A grazing antelope with a mahogany and black coat that lives in herds on African grasslands. Males form ... http://www.interaktv.com/mammals/TubuliArt.html Biologybase: Mammals of the World: Tubulidentata through ...: Connochaetes gnou. Connochaetes taurinus. Damaliscus hunteri. Damaliscus lunatus. Damaliscus pygargus. Sigmoceros lichtensteinii. Antilopinae, Ammodorcas clarkei. ... http://bnhm.berkeley.museum/browse/vertebrates_Mammalia_Artiodactyla_Bovidae_Damaliscus_all.php?ViewResults=vertebrates_Mammalia_Artiodactyla_Bovidae_Damaliscus_all Berkeley Natural History Museums: 26) view specimens Damaliscus albifrons (Unspecified) (13) view specimens Damaliscus dorcas (Unspecified) (5) view specimens Damaliscus lunatus (Unspecified) (5 ... http://www.fact-index.com/g/gr/grazing_antelope.html Grazing antelope: Kobus vardonii. Tribe Alcelaphini: Hirola, Beatragus hunteri; Topi, Damaliscus lunatus; Bontebok, Damaliscus pygargus; Hartebeest, Alcelaphus ... http://www.serengeti.org/deutsch_neu/animals.html Serengeti - Tiere: ...- ... Kuhantilope Alcelaphus buselaphus. Topi Damaliscus lunatus. Weißbartgnu Connochaetus taurinus. ... Topi Damaliscus lunatus. Warzenschwein Phacochoerus africanus. ... http://www.serengeti.org/animals.html Serengeti - Animals: Topi Damaliscus lunatus. White-bearded Wildebeest Connochaetus taurinus. Impala Aepyceros melampus. ... Topi Damaliscus lunatus. Vervet Monkey Cercopithecus aethiops. ... http://hk.geocities.com/odsite005/tanzania/wildlife/topi.htm East Africa Wildlife - Topi / æ?±é?žé‡Žç”Ÿå‹•ç‰©- 轉角牛羚: ...æ?±é?žé‡Žç”Ÿå‹•ç‰©ï¼šTopi / 轉角牛羚. 常用å??稱：. 轉角牛羚, 塔比 羚羊 Topi, Bastard Hartebeest, Tsessebe. å¸å??：. Damaliscus lunatus. ç°¡ 介：. ... http://www.encyclopedia.com/html/d1/damalisk.asp damalisk on Encyclopedia.com: The sassaby, Damaliscus lunatus, is a large damalisk, standing nearly 4 ft (120 cm) at the shoulder; it is found in N South Africa. ... http://www.afrikanische-tiere.de/topis.html Topis: ...- ... Hierher gehören Riesenleierantilopen (Korrigum, Sassaby, Damaliscus lunatus), deren Unterarten als Topi und Jimela bekannt sind, und Hunters Antilope ... http://www.masai-mara.com/mmscx.htm Order: Blesbok. Damaliscus hunteri. Hunter's Hartebeest (Hirola). Damaliscus lunatus. Topi (Tsessebe, Korrigum, or Tiang). Antilopinae. Gazelles and Dwarf Antelope. ... http://www.bfn.de/04/040401.htm Bundesamt für Naturschutz | WA-Vollzug / CITES: ...- ... C EUVO; Impala (Aepyceros melampus) ng; Leierantilope (Damaliscus lunatus) Anhang C EUVO; Kronenducker (Sylvicapra grimmia) ng; Kudu ... http://www.bfn.de/en/04/040401.htm German Federal Agency for Nature Conservation (BfN)| CITES ...: Southern reedbuck (Redunca arundium) np; Topi (Damaliscus lunatus) EU Reg Annex C. Arctic fox (Alopex lagopus) Hab Dir. top of page. Bears. ... http://www.natureportfolio.com/mammals/artiodactyls.php Nature Portfolio - catalogue of photos of even-toed ungulates: Bontebok, Damaliscus pygargus pygargus (D.dorcas). Topi, Damaliscus lunatus jumela (D. korrigum). Coke's Hartebeest, Alcelaphus buselaphus cokii. ... http://artedi.ebc.uu.se/cfg2000/aln/COX3.aln CLUSTAL W (1.8) multiple sequence alignment Saccharomyces ...: Rhizopus stolonifer, COX3 MIEMYDRNYIYNMTTKIMNRSVQAHPFHLVEASPWPIAVSFSLLVV--TLSGVMTFQGYS Damaliscus lunatus, COX3 -----MTHQTHAYHMVNPSPWPLTGALSALLM ... http://home.no.net/trohi/mammalia/artiodactyla/bovidae.html bovidae.html: Tidligere Beatragus hunteri. ", Damaliscus lunatus, HalvmÃ¥neantilope=Topi(Tsessebi,Sasseby)/Inkludert D. korrigum. ", Damaliscus pygargus, ... http://www.jabali.co.za/animals/animaltype.cfm?page=tsessebe.htm Private Game Ranch in South Africa. Game, hiking, mountain biking ...: Tsessebe Afrikaans name : Basterhaartbees Scientific name : Damaliscus lunatus subspecies - Damaliscus lunatus lunatus. Region : Southern ... http://www.painetworks.com/download/0401101_wilderness/ Click on individual thumbnails to view 432 pixel enlargements.: ...national reserve. FileName: db1524.JPG Keywords: kenya africa topi damaliscus lunatus jimela masai mara game reserve. FileName: db1525 ... http://www.outtoafrica.nl/animals/engtopi.html?zenden=2&subsoort_id=2&bestemming_id=1 topi facts: Topi FACT FILE: Swahili Name: Nyamera. Scientific Name: Damaliscus lunatus. Size: 3 1/2 to 4 1/2 feet. Weight: 200 to 300 pounds. Lifespan: 15 years. ... http://perso.club-internet.fr/boudetjo/ZooList/Mammif/ClasArti.html Classification des Artiodactyles: ...- ... Connochaetes Damaliscus Sigmoceros, Alcelaphus buselaphus Connochaetes gnou Connochaetes taurinus Damaliscus hunteri Damaliscus lunatus Damaliscus pygargus ... http://www.animalomnibus.com/eventoed.htm Even-toed Hoofed Mammals: Diversity Web; Honeymoon in Africa; ZOO IN THE WILD. Topi: Animal Diversity Web; ZOO IN THE WILD. Tsessebe - Damaliscus lunatus: ZOO IN ... http://www.icon.co.za/~webotha/prices.htm Prices: Witblesbok. Damaliscus dorcas phillipsi. 350. Tsessebe. Basterhartbees. Damaliscus lunatus. 2000. Blue duiker. Blouduiker. Philantomba monticola. 400. Red duiker. ... http://www.amelia.ne.jp/userProjectTRUnitTable.do?projectId=27&partNumber=7&type=final アメリア翻訳プãƒã‚¸ã‚§ã‚¯ãƒˆ ä¿®æ£è¨³æ–‡å¯¾è¨³è¡¨: 15, In a similar manner, the range for animals such as the lechwe (Kobus leche), zebra (Equus burchelli), tsessebe (Damaliscus lunatus), reedbuck (Redunca ... http://www.amelia.ne.jp/userProjectTRUnitTable.do?projectId=27&partNumber=7&type=tmp アメリア翻訳プãƒã‚¸ã‚§ã‚¯ãƒˆ 仮訳文対訳表: 15 0件, In a similar manner, the range for animals such as the lechwe (Kobus leche), zebra (Equus burchelli), tsessebe (Damaliscus lunatus), reedbuck (Redunca ... http://www.hyperdictionary.com/dictionary/genus+Damaliscus GENUS DAMALISCUS - Meaning and Definition of the Word: Synonyms: Damaliscus. See Also: Bovidae, Damaliscus lunatus, family Bovidae, mammal genus, sassaby, topi. COPYRIGHT © 2000-2003 WEBNOX CORP. ... http://elib.cs.berkeley.edu/photos/fauna/sci-Mammal.html CalPhotos: Browse Mammal Scientific Names: ...(3) Damaliscus hunteri (1) Damaliscus korrigum (3) Damaliscus lunatus (14) Dasyprota sp. (2) Dasyurus geoffroii (2) Dendrolagus sp. ... http://www.markuskappeler.ch/tex/texs/kuhantilope.html Lichtenstein-Kuhantilope: ...- ... sind das Weissschwanz- und das Streifengnu (Connochaetes gnou und Connochaetes taurinus), die Leierantilope und der Buntbock (Damaliscus lunatus und Damaliscus ... http://www.ergo-light.com/ERGO/CGI/prot.cgi?prot=RCY34156&user= Protein Page for RCY34156 from Synechocystis sp. PCC6803: ...tuberculosis, pirnr|NF00164473, 3.17e-19, 357, 19, 2, Cytochrome c oxidase polypeptide III (EC 1.9.3.1), Damaliscus lunatus, pirnr|NF00400778, ... http://land.heim.at/yellowstone/231193/zooresearch/mix-5systematik6.htm Artiodactyla: ...- ... 118. 87. -. -. Connochaetes taurinus taurinus. 28. 19. -. -. Damaliscus lunatus. 49. 40. -. -. Damaliscus lunatus jimela. 5. 1. -. -. Damaliscus pygargus. 100. 70. 2. -. ... http://www.zoosupplies.co.za/available_species.html Species currently available: Blesbok, Damaliscus dorcas phillipsi. Tsessebe, Damaliscus lunatus. Red Hartebeest, Alcelaphus buselaphus. Black Wildebeest (White Tailed Gnu), Connochaetes gnou. ... http://61.9.197.64/savuti/hunting_price.htm Pricelist: Steenbuck, Raphicerus campestris, US$, 200.00, Tsessebe, Damaliscus lunatus, US$, on request, Vervet Monkey, Cercopithecus aerhiops, US$, 75.00, Cites 2, ... http://www.wildlife.gov.my/jadual2.html JADUAL DUA: Ovis canadensis. 28. Bongo. Boocerus eurycerus. 29. Sassaby. Damaliscus lunatus. 30. Black Buck. Antilope cervicapra. 31. Roan Antelope. Hippotragus equinus. 32. ... http://www.rarespecies.org.na/InfoSys/literature/RST_Lit.htm RST - Literature: Child, G., H. Robbel and CP Hepburn (1972). Observations on the biology of the tsessebe, Damaliscus lunatus lunatus, northern Botswana. Mammalia 36: 342-388. ... http://www.up.ac.za/academic/acadorgs/zssa/journal/v7.html Zoologica Africana Vol 7 (1972): Zoologica Africana 7(1):119-140 Joubert SCJ. Territorial behaviour of the Tsessebe (Damaliscus lunatus lunatus Burchell) in the Kruger National Park. ... http://www.natron.net/napha/deutsch/indigenous.html NAPHA: Namibia Professional Hunting Association: Einheimische ...: ...- ... 36. Steinbock, raphicerus campestris. 37. Leierantilope, damaliscus lunatus. 38. Warzenschwein, pacochoerus africanus. 39. Wasserbock, kobus ellipsiprymnus. 40. Gnu, ... http://www.natron.net/napha/english/indigenous.html NAPHA: Namibia Professional Hunting Association: Huntable Species: 36. Steenbok, raphicerus campestris. 37. Tsessebe, damaliscus lunatus. 38. Warthog, pacochoerus africanus. 39. Waterbuck, kobus ellipsiprymnus. 40. Wildebeest, 40.1. ... http://www.djuma.com/gallery_animal.htm Mammal Gallery: ...gnu_thumb.jpg (10065 bytes). TSESSEBE Damaliscus lunatus. (Click the 'thumbnail' for information and larger image). tsesebe_thumb.jpg (12840 bytes). ... http://www.forestlight.co.uk/endangeredspecies.html Forest Light - Endangered Species List: ...land iguana, Ecuador, VU - Vulnerable. Damaliscus lunatus topi, Topi, Kenya, LR - Lower risk. Diceros bicornus, Black rhionceros, Kenya, CR - Critically endangered. ... http://www.wta.org.za/info/animals.htm Game Species: Suni, Soenie, Neotragus moschatus, Artiodactyla, Bovidae, Antilopinae. Tsessebe, Tsessebe/Basterhartbees, Damaliscus lunatus, Artiodactyla, Bovidae, Alcelaphinae. ... http://www.makanyane.com/safari_animals.php Makanyane Safari Lodge - African Safari Holidays, Accommodation in ...: ...blesbok, Damaliscus doras philipsi. tsessebe, Damaliscus lunatus. duiker - common, Sylvicapra grimmia. springbok, Antidoras marsupialis. ... http://www.wildlife-conservation.org/index.php International Foundation For The Conservation Of Wildlife: Tiang ("Damaliscus lunatus tiang"): 5 tiang have been successfully immobilized and ARGOS radio-collared by IGF to study their migration routes during the ... http://www.phthiraptera.org/Mammals/Bovidae.html Mammals: Bovidae: Damaliscus - Sassabies. Damaliscus hunteri (Sclater, PL, 1889) - Hirola; Damaliscus lunatus (Burchell, 1823) - Topi Damalinia baxi Hopkins, 1947 *. ... http://www.esapubs.org/archive/ecol/E084/094/MOMv3.3.txt AF extant Artiodactyla Bovidae Addax nasomaculatus 4.85 70000.3 60 ...: ...- ... pygargus 5.01 102000 75 AF extant Artiodactyla Bovidae Damaliscus hunteri 4.9 80000 "63, 70" AF extant Artiodactyla Bovidae Damaliscus lunatus 5.13 136000.3 "63 ... http://www.esapubs.org/archive/ecol/E084/093/Mammal_lifehistories_v2.txt order family Genus species mass(g) gestation(mo) newborn(g) ...: Bovidae Damaliscus pygargus 84500.00 8.20 6792.00 5.00 -999.00 23.26 260 1.25 -999.00 "1,2,9,23" Artiodactyla Bovidae Damaliscus lunatus 128000.00 7.81 ... http://www.jyi.org/volumes/volume7/issue1/articles/stowe.html Nutrient Content of Floodplain Grasses and Ruminant Feces in the ...: Fecal nutrient content of large herbivores endemic to the Delta (Syncerus caffer, Damaliscus lunatus, Connochaetes Albojubatus, Equus burchelli) was also ... http://zebrarug.com/zoom/tsessebe.htm Animal Bones, Skull Mounts & Animal Skin Rugs - Wildlife Etc.: Description: Tsessebe. Scientific Name: Damaliscus lunatus lunatus Price: $185.00 to $350.00. Contact us for more information: sales@zebrarug.com. ... http://www.panda.org/about_wwf/where_we_work/ecoregions/global200/pages/regions/region097.htm WWF - Global 200: ...white-eared kob (Kobus kob); tiang (Damaliscus lunatus tiang); Mongalla gazelle (Gazella thomsonii albontata), which make large-scale migrations over the ... http://www.panda.org/about_wwf/where_we_work/ecoregions/global200/pages/regions/region089.htm WWF - Global 200: Roan antelope (Hippotragus equinus); lewel hartebeest (Damaliscus lunatus lelwel). General Threats: Significant loss of original wooded ... http://quin.unep-wcmc.org/isdb/Taxonomy/tax-gs-search2.cfm?GenName=Damaliscus&SpcName=lunatus quin.unep-wcmc.org/isdb/Taxonomy/tax-gs-search2.cfm?GenName=Damaliscus&SpcName=lunatus: Similar pages MSL, Order Artiodactyla ... Park, Kenya, 1992. AH Shoemaker Damaliscus lunatus (including D. korrigum) - Topi - Africa; 182 Small herd, Kenya, 1973. SJ Bleiweiss; 472 Subsp. ... http://www.emporia.edu/biosci/msl/artio.htm [an error occurred while processing this directive] Damaliscus lunatus [an error occurred while processing this directive] 6235 Tsessebe, Damalisque, Hirola, Korrigum, Sassaby, Topi Tsessebe, Damalisque, Hirola, Korrigum, Sassaby, Topi Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |