|
Dromiciops gliroides - Monito Del MonteIUCN Status: VulnerableIUCN Species Profile http://animaldiversity.ummz.umich.edu/site/accounts/information/Dromiciops_gliroides.html ADW: Dromiciops gliroides: Information: Dromiciops gliroides (monito del monte). ... Family: Microbiotheriidae. Genus: Dromiciops. Species: Dromiciops gliroides. Geographic Range. ... http://www.itis.usda.gov/servlet/SingleRpt/SingleRpt?search_topic=TSN&search_value=552590 ITIS Standard Report Page: Dromiciops gliroides: Go to Print Version, Dromiciops gliroides Thomas, 1894 Taxonomic Serial No.: 552590. ... Species, Dromiciops gliroides Thomas, 1894 -- monito del monte, References, ... http://www.itis.usda.gov/servlet/SingleRpt/RefRpt?search_type=expert&search_id=expert_id&search_id_value=103 ITIS 'Expert(s)' Search results for Alfred L. Gardner: Dromiciops Thomas, 1894 -- valid -- monito del monte. Dromiciops gliroides Thomas, 1894 -- valid -- monito del monte. Dugong Lacépède, 1799 -- valid -- dugongs. ... http://www.bio.puc.cl/epalma1.htm Pontificia Universidad Católica de Chile. Facultad de Ciencias ...: ...- ... of marsupials based on the rRNA 12S mitochondrial gene: the phylogeny of Didelphimorphia and of the living fossil microbiotheriid Dromiciops gliroides Thomas. ... http://brainmuseum.org/Specimens/marsupalia/Monitodelmonte/ Comparative Mammalian Brain Collections: Monito del monte ...: Monito del monte (Dromiciops gliroides) #70-96. Whole brain photographs. • Standard views. • Special views. • Rotating brain cast. ... http://brainmuseum.org/Specimens/linearlist.html Comparative Mammalian Brain Collections: Linear List of Specimens: Mouse opossum, (Marmosa murina), Cuica, (Thylamys velutinus), Four-eyed opossum, (Philander opossum), ORDER MICROBIOTHERIA. Monito del monte (Dromiciops gliroides). ... http://www.damisela.com/zoo/mam/marsupialia/microbiotheriidae/taxa.htm Dromiciops gliroides: ...- Orden Microbiotheria. Familia Microbiotheriidae. Dromiciops gliroides. TaxonomÃa. El Monito de Monte ( Dromiciops gliroides ) en el Reino Animal. ... http://www.damisela.com/zoo/mam/marsupialia/microbiotheriidae/nombres.htm Monito de Monte: ...- ... Familia Microbiotheriidae. Dromiciops gliroides. Orden Filogenético. ... español, inglés, cientÃfico. Monito del Monte, Monito del Monte, Dromiciops gliroides. ... http://www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=Dromiciops+gliroides+%5Bgbmam%5D Codon usage table: Dromiciops gliroides [gbmam]: 1 CDS's (65 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU 0.0( 0) UCU 30.8( 2 ... http://www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=mitochondrion+Dromiciops+gliroides+%5Bgbmam%5D Codon usage table: ...mitochondrion Dromiciops gliroides [gbmam]: 9 CDS's (2812 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU 27.0 ... http://www.cricyt.edu.ar/INSTITUTOS/iadiza/ojeda/marsupiales/Dromiciops%20gliroides.htm MONITO DE MONTE: ...- MONITO DE MONTE. Dromiciops gliroides. Foto: A. Monjeau. Descripción Grisáceo o bayo con la parte ventral blancuzca; franjas oscuras ... http://encyclopedia.thefreedictionary.com/Dromineer Dromineer - encyclopedia article about Dromineer. Free access, no ...: Dromineer. Word: Word. Dromineer, Co. Tipperary,. Ireland. Dromineer is a small village in County Tipperary. ... http://encyclopedia.thefreedictionary.com/Dromiciops%20gliroides encyclopedia.thefreedictionary.com/Dromiciops%20gliroides: Similar pages APUS.RU | ОпоÑ?Ñ?ум чилийÑ?кий ... ЧилийÑ?кий опоÑ?Ñ?ум - Dromiciops gliroides - единÑ?твенный ныне живущий вид из Ñ?емейÑ?тва Microbiotheriidae ... http://www.apus.ru/site.xp/055054053124050051056052124.html APUS.RU | Род Dromiciops: Род Dromiciops /. Dromiciops australis; ОпоÑ?Ñ?ум чилийÑ?кий Dromiciops gliroides. ГлавнаÑ? Ñ?траница. ... http://www.net-lexikon.de/Australidelphia.html Lexikon - Australidelphia Definition Erklärung Bedeutung: ...- ... und auf nahe gelegenen Inseln heimisch sind, daneben auch noch eine einzige in Südamerika lebende Art, die Chiloë-Beutelratte (Dromiciops gliroides), die in ... http://www.net-lexikon.de/Beutelsaeuger.html Lexikon - Beutelsäuger Definition Erklärung Bedeutung: ...- ... Australidelphia umfassen neben den in Südamerika lebenden Microbiotheria mit der einzigen Art der Chiloë-Beutelratte (Dromiciops gliroides) die Beutelmullen ... http://www.emporia.edu/biosci/msl/microb.htm MSL, Order Microbiotheria: Dromiciops gliroides - Mouse opossum - Chile & Argentina, 725 Side view of captive, La Picada Forest Preserve, Osorno Province, Chile, 1982. PL Meserve ... http://nl.wikipedia.org/wiki/Microbiotheria_(taxonomie) Microbiotheria (taxonomie) - Wikipedia NL: Orde: Microbiotheria. Familie: Microbiotheriidae Geslacht: Dromiciops Soort: Dromiciops gliroides (of D. australis) (Monito del monte). ... http://tolweb.org/tree?group=Marsupialia&contgroup=Mammalia Marsupialia: Hershkovitz, P. 1992. Ankle bones: The Chilean opossum Dromiciops gliroides Thomas, and marsupial phylogeny. Bonner Zoologische Beiträge 43:181–213. ... http://tolweb.org/tree?group=Mammalia&contgroup=Therapsida Mammalia: ...of marsupials based on the rRNA 12S mitochondrial gene: The phylogeny of didelphimorphia and of the living fossil microbiotheriid Dromiciops gliroides Thomas. ... http://www.geocities.com/covs_chile/reglatitu2mamif.html MAMIFEROS:: ...- ... ORDEN PAUCITUBERCULATA. Comadrejita trompuda, Rhyncholestes raphanurus, B. S. P. ORDEN MICROBIOTHERIA, Monito del monte, Dromiciops gliroides, B. S. R. ORDEN EDENTATA. ... http://www.geocities.com/faunadechile/antecedentes.html Fauna de Chile - Antecedentes: ...- ... Chile hay cuatro especies de marsupiales; la Yaca (Thylamys elegans), la Yaca de la puna (Thylamys pallidior), el Monito del Monte (Dromiciops gliroides) y la ... http://www.lib.washington.edu/Msd/LCSH2000.html UW Libraries - LCSH Created by UW Catalogers: Dramatists, Vietnamese. Dromiciops. Dromiciops gliroides. Duckabush River Watershed (Wash.). Dungeness River (Wash.). Dungeness River Watershed (Wash.). Dwarf boas. ... http://www.huinay.cl/terrestre/fauna.htm Fundación Huinay: ...- ... MartÃn Pescador, Ceryle torquata. Mirlo, Molothrus bonariensis. Monito del Monte, Dromiciops gliroides. Peorro, Ceroglossus chilensis. Peuco, Parabuteo unicinctus. ... http://www.terrambiente.org/fauna/Mammiferi/metatheria/microbiotheria/ Microbioteri: ...- ... Microbiotheria, Microbiotheriidae, Dromiciops, dromiciops_gliroides.jpg (122690 byte), Dromiciops gliroides. Area di distribuzione dei microbioteri, ... http://www.fortsasbooks.com/contact.htm Fieldiana Update: Publication # 1502. Hershkovitz, P. Dromiciops gliroides Thomas, 1894, Last of the. Microbiotheria (Marsupialia), with a review of the Family Microbiotheriidae. ... http://www.fortsasbooks.com/zoology/zoology4.htm fortsas Product 4: Hershkovitz, P. Dromiciops gliroides Thomas, 1894, Last of the Microbiotheria (Marsupialia), with a review of the Family Microbiotheriidae, 93, 60, 1502, $30.00. ... http://www.rense.com/general31/veterinarianssplit.htm Veterinarians Split Over Mystery Chilean Humanoid Creature: ...the local wild life, mentioning the possibility that it is a wild cat, or perhaps a so-called monito de monte or mouse opossum (Dromiciops Gliroides), which is ... http://www.animalomnibus.com/marsup.htm Marsupials: Monito del Monte, Colocolos - Dromiciops gliroides: Animal Diversity Web. Mountain Brushtail Possum or Bobuck - Trichosurus caninus: ... http://perso.club-internet.fr/boudetjo/ZooList/Mammif/ClasMars.html Classification des Marsupiaux: ...inca Rhyncholestes raphanurus. Microbiotheria, MICROBIOTHERIIDAE, Dromiciops, Dromiciops gliroides. Dasyuromorphia, DASYURIDAE, Antechinus ... http://www.animalinfo.org/country/chile.htm Animal Info - Chile: ...(Endemic to Chile.); *Magellanic Tuco-tuco (Ctenomys magellanicus). (Not listed in 1996.); Monito del Monte (Marsupial) (Dromiciops gliroides). ... http://www.animalinfo.org/country/argentin.htm Animal Info - Argentina: ...(Not listed in 1996.); Marsh Deer (Blastocerus dichotomus). Monito del Monte (Marsupial) (Dromiciops gliroides). Olrog's Chaco Mouse (Andagalomys olrogi). ... http://tronador.ulagos.cl/jjimenez/galerias/mami5.html Monito del Monte (Dromiciops gliroides: ...- Monito del Monte (Dromiciops gliroides). http://www.sociedadcivil.cl/noalumysa/portada/pagina.asp?p=6 Peligros del aluminio: ...- ... Especie Vulnerable Quique (Galictis cuja). Especie Vulnerable HuillÃn (Lontra provocax) Especie Vulnerable Monito del Monte (Dromiciops gliroides). ... http://www.pubmedcentral.nih.gov/articlerender.fcgi?artid=28379 The interphotoreceptor retinoid binding protein gene in therian ...: Most workers (1, 2, 5) advocate a fundamental division between American marsupials, excepting the South American microbiothere Dromiciops gliroides (monito del ... http://www.smartpedia.com/smart/browse/Special:Allpages&from=Dream_Country SmartPedia.com - Free Online Encyclopedia - Encyclopedia Books.: Dromaius, Dromana, Drome. Dromedary, Dromi, Dromiciops. Dromiciops gliroides, Dromineer, Drone. Drone (disambiguation), Drones Club, Dronfield. ... http://www.scielo.cl/scielo.php?script=sci_arttext&pid=S0717-65382003000100003&lng=en&nrm=iso&tlng=es Gayana (Concepci - <I>FLEAS (INSECTA: SIPHONAPTERA) ON THREE ...: ...- ... El hallazgo de Chiliopsylla allophyla en Abrothrix olivaceus permite sugerir la presencia de Dromiciops gliroides (Philippi, 1893) en los bosques del "Cerro ... http://www.wwf.cl/paginas/vision.htm Visión para la Biodiversidad de la Ecorregión de los Bosques ...: ...- ... Asà también exiten una singularidad de especies animales como el Pudú (Pudu pudu), el Monito del Monte (Dromiciops gliroides), el HuillÃn (Lontra provocax ... http://www.wwf.cl/paginas/PFNahuelbuta.html Nahuelbuta (Tigre grande): ...- ... Estos bosques son el hábitat de animales tales como el marsupial monito del monte (Dromiciops gliroides), el carpintero magallánico o de cabeza roja ... http://www.isem.univ-montp2.fr/PPP/PM/RES/Phylo/Mars/@Didelphidae.php MARSUPIALIA: ...orders (Dasyuromorphia, Diprotodontia, Notoryctemorphia, and Peramelina) and the South American order Microbiotheria, represented by Dromiciops gliroides. ... http://www.loc.gov/catdir/cpso/wls00/awls0004.html LC Subject Headings Weekly List 04 (February 2, 2000): 550 BT Dendroctonus (C) 150 Dromiciops [May Subd Geog] [sp 99010583] 053 QL737.M435 (Zoology) 550 BT Microbiotheriidae (C) 150 Dromiciops gliroides [May Subd ... http://www.nmnh.si.edu/msw/mammals_checklist.txt Monotremata Tachyglossidae Tachyglossus Tachyglossus aculeatus ...: Lestoros Lestoros inca Rhyncholestes Rhyncholestes raphanurus Microbiotheria Microbiotheriidae Dromiciops Dromiciops gliroides Dasyuromorphia Thylacinidae ... http://www.cipma.cl/gef/monito.asp Conservación de la Biodiversidad- Décima Región -Chile: ...- El monito de monte o chimaihuén (Dromiciops gliroides) es el único representante de un orden y una familia de marsupiales, más emparentados con los ... http://www.cipma.cl/gef/ecoregion.asp Conservación de la Biodiversidad- Décima Región -Chile: ...- ... Un ejemplo de esto es el marsupial monito de monte (Dromiciops gliroides), auténtico fósil viviente que solamente se mantiene en este tipo de bosque (Monito ... http://www.bioone.org/bioone/?request=get-document&issn=0022-2372&volume=083&issue=01&page=0301 MamÃferos de Chile: ...information. This results in ambiguity, particularly when new data are presented; eg, reproductive data on Dromiciops gliroides (Figs. ... http://www.bioone.org/bioone/?request=get-citation-links&doi=10.1043/0006-7172(1992)043%3C0181:ABTCOD%3E2.0.CO;2&id=I0022-2372-081-04-1008-HERSHKOVITZ1&sitename=BIOONE Citation Links: CITATION Hershkovitz, P. Ankle bones: the Chilean opossum Dromiciops gliroides Thomas, and marsupial phylogeny Bonner Zoologische Beitrage 1992 vol. ... http://www.psb.ugent.be/rRNA/lsu/list/Mitochondria.html lsu rRNA Mitochondria: Drosophila melanogaster U37541; Mit. Dromaius novaehollandiae U76038; Mit. Dromiciops gliroides U97341; Mit. Drosophila yakuba X03240; Mit. ... http://www.psb.ugent.be/rRNA/ssu/list/Mitochondria.html ssu rRNA Mitochondria: Dromaius novaehollandiae AJ002924; Mit. Drosophila melanogaster U37541; Mit. Dromiciops gliroides U61073; Mit. Drosophila virilis X05914; Mit. ... http://www.mavicanet.ru/directory/eng/21756.html Monito del Monte (Microbiotheriidae) - MavicaNET: Select site, Dromiciops gliroides (Monito del Monte, Colocolos) - English URL: http://animaldiversity.ummz.umich.edu/accounts/dromiciops/d._gliroides$media.htm. ... http://www.biocarampangue.dm.cl/Plan-tercero-evolucion.htm Plan-tercero-evolucion: ...- ... Mecanismos de dispersión de semillas: Cardo (Cynara cardunculus); Almacenamiento de nutrientes en perÃodo invernal: Monito del monte (Dromiciops gliroides); ... http://www.nature.com/doifinder/10.1038%2F40386 Endemic African mammals shake the phylogenetic tree: Accession numbers for the new mitochondrial sequences (Echymipera kalubu (bandicoot); Dromiciops gliroides (monito del monte); Sorex palustris (shrew); Manis sp ... http://www.gwdg.de/service/info-all/gen-sequenz/db_metazoa_mito_link.html mitochondriale Gensequenzen (Metazoen): Dirofilaria immitis. Dogania subplana. Dromaius novaehollandiae. Dromiciops gliroides. Drosophila mauritiana. Drosophila melanogaster. Drosophila sechellia. ... http://www.birdlist.org/sam/argentina/ar_mammals.htm AR mammals: Thylamys, pusilla, Common Fat-tailed Opossum, Marmosa Común, P. Dromiciops, gliroides, Mouse Opossum, Monito Del Monte, Monito del Monte, P. ... http://www.birdlist.org/biodiversity/mammals/allmammals/mammallist1.htm Mammallist1: Osgood, 1924. MICROBIOTHERIA, Microbiotheriidae, Dromiciops, gliroides, Mouse Opossum, Monito Del Monte, Thomas, 1894. DASYUROMORPHIA, Thylacinidae, ... http://www.publish.csiro.au/nid/90/paper/ZO96030.htm CSIRO PUBLISHING - Australian Journal of Zoology: In particular, the affinities of the American marsupial Dromiciops gliroides with, and the distinctness of marsupial bandicoots from, Australasian metatherians ... http://ovni.cl/noticias/noticia001b.htm OVNI.CL Noticias: ...- Extraña criatura es reconocida por veterinario como un posible Monito de Monte ... FICHA TECNICA DE UN MONITO DE MONTE MONITO DE MONTE Dromiciops gliroides. ... http://www.savci.upol.cz/kolokolo.htm Microbiotheria - Kolokolové: DÅ™Ãve byli Å™azeni do Ä?eledi Didelphidae. ÄŒeleÄ?: kolokolovità (Microbiotheriidae) - Microbiothers: Dromiciops gliroides Thomas, 1894 - kolokolo (syn. ... http://www.savci.upol.cz/gal/_2/microbiotheria.htm Microbiotheria - Kolokolové; Galerie - Savci.upol.cz: ...kolokolo, Dromiciops gliroides ©JPG 10kB 189×154, ... http://filin.km.ru/mammels/opossum.htm опоÑ?Ñ?умовые: ЧИЛОÐСКИЙ ОПОССУМ (Dromiciops gliroides) РаÑ?проÑ?транен в южных и центральный районах Чили. ... http://ecociencia.fateback.com/Fauna.htm Pagina nueva 1: ...- ... valiosa especie. MONITO DEL MONTE, Dromiciops gliroides El cuerpo del monito del monte es apenas mas grande que el de una babosa. Es ... http://peopleandwildlife.org.uk/canid-db-show-full.php?item=18 Canid Database - Showing Full Entry (18): ...disturbance results in the lacking of refuges, and nest habitat for two species of endemic South American marsupials (Dromiciops gliroides, and Rhyncholestes ... http://www.forum.umontreal.ca/numeros/1998-1999/Forum99-02-22/article06.html UdeM:Forum/La classification des marsupiaux corrigée par la ...: ...- ... espèces. Toutes les espèces semblent avoir été correctement classées, sauf une: le "monito del monte" (Dromiciops gliroides). ... http://icbm.cl/investigacion/ficha.php?rut=4173970-3 Instituo de Ciencias Biomédicas - Universidad de Chile - Facultad ...: ...- ... based on the rRNA 12S mitochondrialgene: the phylogeny of Didelphimorphia and of the living fossil microbiotheriid Dromiciops gliroides Thomas , Molecular ... http://icbm.cl/investigacion/publicacion.php?id=738A738 ICBM: ...based on the rRNA 12S mitochondrialgene: the phylogeny of Didelphimorphia and of the living fossil microbiotheriid Dromiciops gliroides Thomas Molecular ... http://www.conicyt.cl/comunicados/conicyt-prensa/2004/abril/8abril/monito.html Comisión Nacional de Investigación CientÃfica y Tecnológica ...: ...- ... Ver imagen ampliada Se trata del monito del monte (Dromiciops gliroides), uno de los cuatro marsupiales que viven en Chile y el único más emparentado ... http://www.mbfys.kun.nl/mbfys/education/medical/webteach/brains/marsupia.htm Brain Collections: MARSUPIALS: ORDER MICROBIOTHERIA. Monito del monte ((Dromiciops gliroides). ORDER DAYUROMORPHIA. Native cat (Dasyurus viverrinus). Tasmanian devil (Sarcophilus laniarus). ... http://www.worldwildlife.org/wildworld/profiles/terrestrial/nt/nt0404_full.html Terrestrial Ecoregions -- Valdivian temperate forests (NT0404): This is the case with Dromiciops gliroides, an arboreal marsupial found in this ecoregion, located in the basal trunk of Australasian and American marsupials ... http://www.gwu.edu/~clade/faculty/allard/report.html FINAL REPORT FOR AWARD # 9629319: The four taxa Didelphis virginiana, Macropus giganteus, Macropus robustus, and Dromiciops gliroides, were used to root trees in analyses conducted with both ... http://www.goclock.com/relojes/extincion/p.MjBiNWUxY2Y4NrgzvmXld3uEbXF1cTqu/ GoClock : Próxima extinción: Monito del Monte: ...- ... como añadir un comentario , añadirlo a tus favoritos , ponerlo en tu web.Te cuento sobre este reloj : Extinción del Dromiciops gliroides también conocido ... http://www.mujweb.cz/Veda/traxler/senplac.htm superordo : SENPLACENTULOJ - Metatheria (Aplacentalia) - vaÄ?natci: ...specio). genro : kolokolo - Dromiciops - kolokolo. specio : kolokolo glireska - Dromiciops gliroides - kolokolo plchovitÅ. ordo : malmultetuberuloj ... http://uniblast.genomics.org.cn/sample/glycolysis/uniblast2/21881/uniBLAST.html uniBLAST: ...kinase. gb|AF011238.1|AF011238, 317, 2e-83, 0.15, 0.98, Dromiciops gliroides phosphoglycerate kinase (PGK-1) gene, partial cds. gb|AF011236 ... http://www.darwinac.com/peninsulavaldes/patagonia/animals/mammals/mamacheck.htm checklist mamiferos: CAENOLESTIDAE: Rhyncholestes raphanurus. MICROBIOTHERIIDAE: Dromiciops gliroides (D. australis). DASYPODIDAE: Chaetophractus villosus, Zaedius pichiy. ... http://www.textbookleague.org/96campy.htm Reviewing 'Biology' (fourth edition 1996; Benjamin/Cummings ...: ...genera and three families. (The family Microbiotheriidae comprises just one species, Dromiciops gliroides. This highly distinctive ... http://www.pnas.org/cgi/content/full/95/17/9967 PNAS -- Stanhope et al. 95 (17): 9967: Rodentia), rat (Rattus norvegicus; Rodentia), guinea pig (Cavia porcellus; Rodentia), monito del monte (Dromiciops gliroides; Marsupialia), wallaroo (Macropus ... http://sege.ntu.edu.sg/cgi-bin/extract_info.pl?dbase=gbmam&field=protein&pop=63&type=1 Your Search Results: N}IPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK > 55576_DRCPRP1A Dromiciops australis protamine P1 gene, complete cds.!Nuclear !Orgn:Dromiciops gliroides =nid(g598110 ... http://www.nih.go.jp/yoken/genebank/MNCb/seq5/MNCb-1259.BLA BLASTN 2.0a2MP-WashU [20-Oct-1996] [Build 22:58:53 Oct 20 1996] ...: 1336 5.4e-54 1 gb|U97339|MAM ERU97339 Elephantulus rufescens 12S ribo... 1333 5.6e-54 1 gb|U97341|MAM DAU97341 Dromiciops gliroides 16S riboso... ... http://www.blackwell-synergy.com/links/doi/10.1046/j.1439-0469.2002.00173.x/abs/ Patterns of evolutionary transformation in the petrosal bone and ...: Although we were not able to locate the transverse canal foramen in one specimen of Dromiciops gliroides (AMNH 92147), it is present in all other specimens ... http://bioinformatics.weizmann.ac.il/databases/embl/align/ds34832.dat TITLE: Sequence alignment of the mitochondrial 12S, tRNA Valine ...: ...(Pangolin) U97340, U61079 Ornithorhynchus anatinus (Platypus) U33498, X83427 Didelphis virginiana (Opossum) Z29573 Dromiciops gliroides (Monitodel) U97341 ... http://genome.jouy.inra.fr/db/gcg/embl/em_om_000.seq Q9N1N1 6/2003 ASCII Len: 159 Q9n1n1 papio hamadryas (hamadryas ...: O18859 3/2004 ASCII Len: 425 O18859 dromiciops australis (monito del monte) (dromiciops gliroides). interphotoreceptor retinoid binding protein (fragment). ... http://www.infobiogen.fr/db/embl-align/ds38659.dat TITLE: Alignment of 12S rRNA sequences from 118 mammalian taxa ...: Tenrec ecaudatus AF153002 SPA Solenodon paradoxus AF153006 OCU Oryctolagus cuniculus - ERU Elephantulus rufescens U97339 DGL Dromiciops gliroides U61073 DVI ... http://www.infobiogen.fr/db/index-lassap/sptrembl/mam.seq Q9N1N1 #AC Q9N1N1; #OS PAPIO HAMADRYAS (HAMADRYAS BABOON). #DE ...: O18859 #AC O18859; #OS DROMICIOPS AUSTRALIS (MONITO DEL MONTE) (DROMICIOPS GLIROIDES). #DE INTERPHOTORECEPTOR RETINOID BINDING PROTEIN (FRAGMENT). ... http://www.caece.edu.ar/fundacionhn/Investigacion/fa010.htm [an error occurred while processing this directive] Dromiciops gliroides [an error occurred while processing this directive] 6834 Monito Del Monte Monito Del Monte Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |