|
|
Echinops telfairi - Lesser Hedgehog Tenrec, Small Madagascar "Hedgehog"IUCN Status: Lower Risk/Least ConcernIUCN Species Profile http://animaldiversity.ummz.umich.edu/site/accounts/classification/Echinops_telfairi.html ADW: Echinops telfairi: Classification: Echinops telfairi (lesser hedgehog tenrec). Information; Pictures; Classification. What do these icons mean? ... Species Echinops telfairi (lesser hedgehog tenrec). ... http://www.kleinerigeltanrek.xc2.de/ Haltung des Kleinen Igeltanreks im Terrarium: ...- Viele Links zu Züchtern sowie a Igeltanrek, Kleiner Tanrek, Tanrek, Tenrek, Tenrec, Echinops telfairi, Zwergigel, Weißbauchigel, Langohrigel, Kleinsäuger ... http://www.tenrec.org/kmt79.htm Handrearing Pigmy Hedgehog Tenrec Echinops telfairi at the Jersey ...: Handrearing Pigmy Hedgehog Tenrec Echinops telfairi at the Jersey Wildlife Preservation Trust. ... Recommended feeding regime for handrearing Echinops telfairi. ... http://www.tenrec.org/bagartik.htm Anmerkungen zum Kleinen Igeltanrek (Echinops telfairi): ...- Zurück zu Tanrek-Ressourcen und Informationen. Anmerkungen zum Kleinen Igeltanrek (Echinops telfairi). ... http://members.boardhost.com/tenrec/msg/35.html Tenrec Forum: Echinops telfairi: Echinops telfairi ... Responses: Re: Echinops telfairi mardou September 12, 2000, 20:31:02: Re: Echinops telfairi David Kupitz May 22, 2000, 22:17:13: ... http://members.boardhost.com/tenrec/msg/36.html Tenrec Forum: Re: Echinops telfairi: Forum ]. Re: Echinops telfairi Posted by David Kupitz on May 22, 2000, 22:17:13 , in reply to "Echinops telfairi" 62.180.1.216. It's ... http://hometown.aol.de/kleinerTanrek/ Informationen zu Echinops telfairi ( Kleiner Igeltanrek ): ...- ... Der kleine Igeltanrek. lat.: Echinops telfairi. Ich bewerbe mich im Moment für den Besucher-Award. [ Vorkommen ]. [ Lebensweise ]. [ Ernährung ]. [ Anschaffung ]. ... http://hometown.aol.de/kleinertanrek/ Informationen zu Echinops telfairi ( Kleiner Igeltanrek ): ...- online seit. 16.04.2004. letzte Änderung. 29.05.2004. Der kleine Igeltanrek. lat.: Echinops telfairi. [ Vorkommen ]. [ Lebensweise ]. [ Ernährung ]. [ Anschaffung ]. ... http://members.lycos.nl/JUNGLECORNER/MED04.html Echinops telfairi / boomegeltjes uit Madagascar: Echinops telfairi Boomegeltjes uit Madagascar. De boomegeltjes,Echinops telfairi genaamd, behoren tot de familie der Tenrecinae (oftewel ... http://www.enimal.de/item_detail.php?&itemid=469&refcatid=44&offset=0&orderby=insertdate enimal.de - Echinops telfairi (Kleiner Igeltanrek): ...- enimal.de - Echinops telfairi (Kleiner Igeltanrek) - Tiere im Internet - Tiere, Hunde, Katzen, Nager, Pferde, Vögel, Reptilien, Tiere suchen ein Zuhause. ... http://www.enimal.de/category.php?&categoryid=44 enimal.de - Kleintiere: ...- ... Details. Echinops telfairi (Kleiner Igeltanrek), Echinops telfairi (Kleiner Ige ... | € 110,00 » 558 Zugriffe seit dem 31.01.2004. ... http://www.terrainspira.ch/berichte/kurzbeschreibungen/echinops_telfairi.html Kleiner Igeltanrek, Echinops telfairi: ...- Kleiner Igeltanrek Echinops telfairi. Kurzportrait. Deutscher Name: Kleiner Igeltanrek Wissenschaftlicher Name: Echinops telfairi. Verbreitung: Madagaskar. ... http://www.fab-design.de/Tierfotos/tanrek1.htm Echinops telfairi Männchen: ...- www.fab-design.de/Tierfotos/tanrek1.htm - 1k - Cached - Similar pages Echinops telfairi Männchen - www.fab-design.de/Tierfotos/tanrek2.htm - 1k - Cached - Similar pages[ More results from www.fab-design.de ] Retinofugal projections in hedgehog-tenrecs (Echinops telfairi and ...Retinofugal projections in hedgehog-tenrecs (Echinops telfairi and Setifer setosus). Kunzle H. Anatomische Anstalt, Universitat ... http://www.fab-design.de/Tierfotos/tanrek2.htm Echinops telfairi Männchen: ...- www.fab-design.de/Tierfotos/tanrek2.htm - 1k - Cached - Similar pages[ More results from www.fab-design.de ] Retinofugal projections in hedgehog-tenrecs (Echinops telfairi and ...Retinofugal projections in hedgehog-tenrecs (Echinops telfairi and Setifer setosus). Kunzle H. Anatomische Anstalt, Universitat ... http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&list_uids=3377203&dopt=Abstract Retinofugal projections in hedgehog-tenrecs (Echinops telfairi and ...: Retinofugal projections in hedgehog-tenrecs (Echinops telfairi and Setifer setosus). Kunzle H. Anatomische Anstalt, Universitat ... http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&list_uids=5874922&dopt=Abstract [Odor marking of the tenrec (Echinops telfairi Martin)]: ...[Odor marking of the tenrec (Echinops telfairi Martin)] [Article in German] Eibl-Eibesfeldt I. MeSH Terms: Animals; Behavior, Animal ... http://www.tenrec.tsx.org/ http://www.june9.com/index.html: ...http://www.june9.com/index.html. http://else.hebis.de/cgi-bin/sciserv.pl?collection=journals&journal=01434004&issue=v25i2-3&article=218_sotdpottet Structure of the Definitive Placenta of the Tenrec, Echinops ...: 218-232. Title: Structure of the Definitive Placenta of the Tenrec, Echinops telfairi. Authors: Carter, AM a ; Blankenship, TN b ; Künzle, H. c ; Enders, AC b. ... http://verzeichnis.naturecom.de/saeuger/seiten/581.html NatureCom.de - Webverzeichnis: Wildtiere: Säugetiere - Der Kleine ...: ...- viventura-Reisen. zum Index! Kategorien: Säugetiere Kleinsäuger Terraristik Buchtipp Säugetiere, Der Kleine Igeltanrek (Echinops telfairi). ... http://www.das-tierlexikon.de/tenreks.htm Tenreks: ...- ... Und zum anderen ist das der Kleine Igeltenrek (Echinops telfairi), der eigentlich genauso aussieht aber nur fast genauso groß ist wie sein Vetter der Große ... http://www.das-tierlexikon.de/inhalt_t.htm Taschenmäuse: ...- ... Tenreks oder Tanreks. - Tenrecidae. - Borstenigel. - Echinops. - Echinops telfairi (B). - Erdtenrek. - Geogale. - Geogale aurita. - Großer Igeltenrek (B). ... http://www.omne-vivum.com/b/2929.htm genus Echinops- -: T" "Echinops telfairi species: Echinops telfairi. ... http://www.cbs.dtu.dk/services/GenomeAtlas/show-atlas.php?segmentid=Etelfairi_Strain_mtDNA&type=ALL DNA Structural Analysis of Sequenced Microbial Genomes: Atlases for Echinops telfairi mtDNA strain. Genome Atlas for Echinops telfairi mtDNA (CIR). Structure Atlas for Echinops telfairi mtDNA (CIR). ... http://www.cbs.dtu.dk/services/GenomeAtlas/show-download.php?segmentid=Etelfairi_Strain_mtDNA DNA Structural Analysis of Sequenced Microbial Genomes - Genome ...: Genome Atlas Download Center. Sequence information and Results of Analysis for Echinops telfairi Strain (mtDNA). Accession No. NC_002631. ... http://www.sfcelticmusic.com/js/LEMURS/locallem.htm Local Lemurs & Lorises (USA): Cryptoprocta ferox, Fossa; Echinops telfairi, Small Madagascar hedgehog tenrec; Setifer setosus, Large Madagascar hedgehog tenrec. San Francisco Zoo. ... http://www.sfcelticmusic.com/js/LEMURS/captvspp.htm Captive Prosimians and Madagascar fauna -- Location by Species: Lemur variegatus. Other Madagascar Mammal Fauna in the ISIS database: Hypogeomys antimena Malagasy rat; Echinops telfairi Small Madagascar hedgehog tenrec; ... http://www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=mitochondrion+Echinops+telfairi+%5Bgbmam%5D Codon usage table: ...mitochondrion Echinops telfairi [gbmam]: 29 CDS's (8266 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU 39.1( 323 ... http://www.hobbygarten.com/galerie/tiere/garten/tiere.htm hobbygarten.com Leopardgecko Igeltanrek Tanrek Wespenspinne Tiere ...: ...- ... Killy, Marienkäfer Coccinellidae, Schmetterling, Tagpfauenauge, Igeltanrek Echinops telfairi, Igeltanrek Echinops telfairi. ... http://www.press.jhu.edu/books/walkers_mammals_of_the_world/insectivora/images/image.insectivora.tenrecidae.echinops.html Thumbnails Page, Insectivora Tenrecidae Echinops: Small Madagascar "hedgehog" (Echinops telfairi), photo by Howard E. Uible. Small Madagascar "hedgehog" (Echinops telfairi), photo by Martin E. Nicoll. ... http://www.press.jhu.edu/books/walkers_mammals_of_the_world/insectivora/images/image.mid.insectivora.tenrecidae.echinops.telfairi.2.html Image Page, Insectivora Tenrecidae Echinops: Insectivora Tenrecidae Echinops. Small Madagascar "hedgehog" (Echinops telfairi), photo by Martin E. Nicoll. Return to Genus Copyright ... http://www.floranimal.ru/pages/animal/t/1268.html ТЕÐ?РЕК ИГЛИСТЫЙ: ТЕÐ?РЕК ИГЛИСТЫЙ (Echinops telfairi). ... ТЕÐ?РЕК ИГЛИСТЫЙ (Echinops telfairi) зверек Ñ?редней величины. ... http://www.blackwell-synergy.com/Journals/processfree2.asp?contentid=zsc.2000.4&filetype=abstracts&article=75370 Phylogenetic position of the Tenrecs (Mammalia: Tenrecidae) of ...: Phylogenetic position of the Tenrecs (Mammalia: Tenrecidae) of Madagascar based on analysis of the complete mitochondrial genome sequence of Echinops telfairi. ... http://www.blackwell-synergy.com/links/doi/10.1046/j.1460-9568.1998.00020.x/enhancedabs/ Origin and terminal distribution of the trigeminal projections to ...: ...trigemino tectal projections were investigated with anterograde and retrograde tracing techniques in the Madagascan lesser hedgehog tenrec, Echinops telfairi. ... http://www.planet-interkom.de/david.kupitz/bagartik.htm Transfer zu neuer Adresse: ...- Umgezogen nach www.tenrec.org, http://www.reptil-zoo.dk/Arter_AND_UK.html Mammals, insects etc. (TERRARIET's portraits): Lesser Hedgehog Tenrec (Echinops telfairi). Red-necked Wallaby (Macropus rufogriseus). Common Marmoset (Callithrix jacchus). Giant ... http://www.reptil-zoo.dk/Arter_AND.html Pattedyr, insekter mm (TERRARIETs portrætter): Stribet børstesvin (Echinops telfairi). Rødhalset kænguru (Macropus rufogriseus). Hvidøret silkeabe (Callithrix jacchus). Kæmpegræshoppe ... http://www.biology-x.com/biology-x/hedgehog.html hedgehog Information (tenrec): Echinops telfairi (Small Madagascar Hedgehog, Lesser Hedgehog Tenrec) Article about the biology of this tenrec, by Bridget Fahey for Animal Diversity Web. ... http://www.chaffeezoo.org/animals/tenrecs.html Tenrecs | Animal Facts | Chaffee Zoological Gardens of Fresno: CLASS: Mammalia. ORDER: Insectivora. FAMILY: Tenrecidae SUBfamily: Oryzoryctinae, Potamogalinae, Tenrecinae. GENUS & SPECIES: Echinops telfairi. CLASSIFICATION: ... http://www.ferpharm.dk/shop/varer.asp?kategori=Mammals Onlinehandel: Echinops telfairi Antal Bestil. Type: Echinops telfairi. MÃ¥l: ... http://www.mavicanet.ru/directory/eng/21718.html Tenrecs, or Madagascar "Hedgehogs" (Tenrecidae) - MavicaNET: Select site, Echinops telfairi, Small Madagascar Hedgehog Tenrec - English URL: http://animaldiversity.ummz.umich.edu/accounts/echinops/e._telfairi$narrative.ht. ... http://www.mavicanet.ru/directory/eng/7163.html Insectivores (Insectivora) - MavicaNET: ...for the 17-year-old Lesser Hedgehog Tenrec female "Pancake" including pictures and three videos on this old lady, probably the oldest Echinops telfairi in the ... http://search.looksmart.com/p/browse/us1/us317914/us146762/us217721/us1174306/ LookSmart - Directory - Tenrecs: ...ecaudatus. Animal Diversity Web - Lesser Hedgehog Tenrec Read of the geographic range and of the behaviors of Echinops telfairi. Animal ... http://www.soe.ucsc.edu/research/compbio/yeast-protein-predictions/Q027/Q0275/Q0275.t2k.pa.html a2m2html output for file tmp.a2m: ...unicornis]. gi|11994083|ref|NP_072063.1|COX3_15563_3:260 cytochrome c oxidase subunit III [Echinops telfairi]; gi|11967792|emb|CAC19398 ... http://www.vox.de/28500_detailview.php?mainid=tanrek_igel&bereich=Tiere&area=tier VOX: ...- Kleiner Igeltanrek (Echinops telfairi): Der Kleine Igeltanrek gehört innerhalb der Familie der Tanreks (Tenrecidae) zur Ordnung der Insektenfresser (Insectivora ... http://edoc.ub.uni-muenchen.de/archive/00001465/ Digitale Hochschulschriften der LMU - Ultrastrukturelle und ...: ...- Vonnahme, Patrick (2003): Ultrastrukturelle und immunhistochemische Untersuchungen an den C-Zellen der Schilddrüse des kleinen Igel Tenrek, Echinops Telfairi. ... http://www.koelle-zoo.de/special/ Kölle-Zoo - Special: ...- Tanreks (Tenrecidae). Kleiner Igeltanrek Echinops telfairi. Gruppe: Insektenfresser der eigenen Ordnung Tenrecidae. Verwandte, Tanreks (Eigene Ordnung). ... http://www.forum-pets.de/showthread.php?goto=newpost&t=12231 Forum Haustiere - Igeltanreks: ...- ... Sind so nette Tiere. Angehängte Grafiken, 0,1 echinops telfairi 5.jpg (122,1 KB, 124x aufgerufen). ... Hallo Sebastian, Also ich halte Echinops telfairi. ... http://getentry.ddbj.nig.ac.jp/cgi-bin/get_entry.pl?Y17692 Get Entry: Your query was: Y17692 LOCUS ETY17692 1153 bp DNA linear MAM 25-AUG-1998 DEFINITION Echinops telfairi gene encoding alpha adrenergic receptor subtype 2B. ... http://www.apus.ru/site.xp/056049051124.html APUS.RU | ПодÑ?емейÑ?тво ·Тенреки - Tenrecinae: Tenrec ecaudatus, Тенрек-еж - Setifer setosus, Малый мадагаÑ?карÑ?кий еж, или Малый тенрек-еж - Echinops telfairi. ... http://www.mnzoo.com/animals/tropics_trail/tenrec_2.asp Minnesota Zoo/Animals/Tropics Trail: Animal Search AZ. Echinops telfairi. SPINY TENREC CONTINUED. Range: Western and southwestern Madagascar. Habitat: Dry, deciduous forest ... http://bnhm.berkeley.museum/browse/vertebrates_Mammalia_Insectivora_Tenrecidae_Echinops_all.php?ViewResults=vertebrates_Mammalia_Insectivora_Tenrecidae_Echinops_all Berkeley Natural History Museums: Browse Genus equals Echinops by Scientific Name for All Museums, Genus: Echinops view specimens Echinops telfairi (Unspecified) (7) view specimens. Google. ... http://www.palaeos.com/Vertebrates/Units/460Insectivora/460.300.html Palaeos Vertebrates 460.300 Insectivora: Soricomorpha: ...(abstract); 食虫目 (Chinese: brief discussion of phylogeny); Echinops telfairi (are the sister group of elephants ... right). References: Asher et al. ... http://www.palaeos.com/Vertebrates/Units/460Insectivora/460References.html Palaeos Vertebrates 460 Insectivora References: ...position of the Tenrecs (Mammalia: Tenrecidae) of Madagascar based on analysis of the complete mitochondrial genome sequence of Echinops telfairi, Zool. ... http://arc.cs.odu.edu:8080/dp9/getrecord/oai_dc/edoc.ub.uni-muenchen.de/oai:edoc.ub.uni-muenchen.de:1465 Ultrastrukturelle und immunhistochemische Untersuchungen an den C ...: ...- ... Dublin Core Metadata. Title, Ultrastrukturelle und immunhistochemische Untersuchungen an den C-Zellen der Schilddrüse des kleinen Igel Tenrek, Echinops Telfairi. ... http://arc.cs.odu.edu:8080/dp9/getrecord/oai_dc/harvester.pkp.ubc.ca/oai:harvester.pkp.ubc.ca:record/8202 Ultrastrukturelle und immunhistochemische Untersuchungen an den C ...: Title, Ultrastrukturelle und immunhistochemische Untersuchungen an den C-Zellen der Schilddrüse des kleinen Igel Tenrek, Echinops Telfairi. ... http://www.sciencedaily.com/directory/Science/Biology/Flora_and_Fauna/Animalia/Chordata/Mammalia/Insectivora/Tenrecs ScienceDaily -- Browse Topics: Science/Biology/Flora_and_Fauna ...: Echinops telfairi (Small Madagascar Hedgehog, Lesser Hedgehog Tenrec) - Article about the biology of this tenrec, by Bridget Fahey for Animal Diversity Web. ... http://www.terraristika.biz/exotic-animal/kleinanzeiger/index.php?action=auswahl&kategorie=Suche&Show=30 Kleinanzeiger: ...- ... Kleinanzeigentext: Hallo, ich suche den Kleinen Igeltanrek (Echinops telfairi), am liebsten wären mir 2 junge Weibchen aus einem Wurf. Anzeige Nr.: 524. ... http://www.terraristika.biz/exotic-animal/kleinanzeiger/index.php?action=auswahl&kategorie=Suche&Show=120 Kleinanzeiger: ...- ... Hallo, suche wenn möglich zwei Igeltanrek( Echinops telfairi)kleiner Tanrek Männchen und Weibchen alter ist eigendlich egal.Aber bitte keinen streifentanrek. ... http://www.reptielenforum.nl/forum/index.php?showforum=19 ReptielenForum -> Overige Dieren: Storm. Mijn Tenrec! (Pagina's 1 2 ) Echinops telfairi, Heterodon, 33, 246, 12 mei 2004, 21:48 Laatste post door: Heterodon. stink hond, ... http://www.tierseiten.com/insektenfresser/insektenfressersystematik.html Systematik der Insektenfresser: ...- ... Tenrecinae (Borstenigel) Gattung: Dasogale Art: Dasogale fontoynonti (Fontoynonts Igeltanrek) Gattung: Echinops Art: Echinops telfairi (Kleiner Igeltanrek ... http://members.aol.com/andreaswosch/AnimalLand/Tanrek.htm Kleiner Igeltanrek: ...- Kleiner Igeltanrek. Engl.: Lesser Hedgehog Tenrec Lat.: Echinops telfairi. Vorkommen: Der Igeltanrek bewohnt die halbtrockenen Gras ... http://www.tiere-im-terrarium.de/modules.php?name=MS_TopSites&file=stats&id=28 Tiere im Terrarium: ...- ... ¿ Statistiken für Seite: Echinops telfairi der Kleine Igeltanrek ?>. Echinops telfairi der Kleine Igeltanrek. [ NO BUTTON ]. http ... http://www.lmu-neuroanatomie.de/neurosysteme.html LMU Neuroanatomie III - Evolution neuronaler Systeme von ...: ...- ... Schwerpunkt der Untersuchungen ist dabei das wenig differenzierte Gehirn des Tenrek (Echinops telfairi), einem basalen placentalen Säuger. ... http://natzoo.si.edu/Animals/AnimalIndex/mammals.cfm Mammal Index - National Zoo| FONZ: Order Insectivora (Insectivores such as shrews). Family Tenrecidae (Tenrecs). Echinops telfairi - Small Madagascar hedgehog tenrec. Order Scandentia (Tree shrews). ... http://www.nickgarbutt.com/stock_photos/mammals.htm Mammal Photos of Madagascar Africa and India: Tenrecs. · Common Tenrec (Tenrec ecaudatus) · Greater Hedgehog Tenrec (Setifer setosus) · Lesser Hedgehog Tenrec (Echinops telfairi) · Lowland Streaked ... http://www.schulzoo.de/berichte/berichte.php Schulzoo-Leipzig eV: ...- ... Weiter >>. Bemerkungen zum Kleinen Igeltanrek (Echinops telfairi Martin, 1838). Autor: Christiane Krause, Datum: 24.08.2003, Weiter >>. ... http://www.life.umd.edu/classroom/bsci338m/Image_Archives/Insectivora/Insectivora.html Mammalogy Image Archives: Insectivora: ...aquaticus). Family Tenrecidae: LINK TO tenrec (Echinops telfairi); LINK TO tenrec (Echinops telfairi). Family Chrysochloridae: golden ... http://www.glenoakzoo.org/Common%20Name.htm Common Name: 20. HEDGEHOG. Atelerix albiventris. 88. LESSER MADAGASCAR HEDGEHOG TENREC. Echinops telfairi. 113. LONG-EARED HEDGEHOG. Hemiechinus auritus. 22. SOUTH AFRICAN HEDGEHOG. ... http://www.glenoakzoo.org/scientific_name.htm Scientific Name: 87. Echinoprocta rufescens. UPPER AMAZONIAN PORCUPINE. 88. Echinops telfairi. LESSER MADAGASCAR HEDGEHOG TENREC. 89. Eliomys melanurus. GARDEN DORMOUSE. 90. ... http://www.zoopraha.cz/zvirata_v_cislech.php?d=3 Zoo Praha - Procházka po zoo - Panorama: 0. bizon, Bison bison, 1, 5, 0, 0, 0, 0. bodlÃn Telfairův, Echinops telfairi, 1, 1, 0, 0, 0, 0. bongo, Tragelaphus eurycerus isaaci, 3, 8, 0, 1, 1, 0. ... http://megasun.bch.umontreal.ca/ogmp/projects/other/all_list.html All complete organelle genome sequences: Mitochondrion, AB099484, AB099484, 18-DEC-2003, Echinops telfairi [Chordata], -. Mitochondrion, ETE400734, AJ400734, 04-JUL-2003, Echinops telfairi [Chordata], -. ... http://www.emporia.edu/biosci/msl/insecti.htm MSL, Order Insectivora: M Andrea Family TENRECIDAE - Tenrecs. Echinops telfairi - Lesser hedgehog-tenrec - Madagascar (Malagasy Republic); 25 Side view, Nat. Zool. ... http://zeal.com/category/preview.jhtml?cid=1174306 Zeal.com - United States - New - Library - Sciences - Animals & ...: ...edu/accounts/echinops/e._t... Read of the geographic range and of the behaviors of Echinops telfairi. 4. Animal Diversity Web - Tenrecidae ... http://anmelden.net/article-topic73-page17.html Homepage anmelden kostenlos bekannt machen, anmeldung, eintrag ...: ...- ... Eingetragen am 21. April 2004. Informationen zum Kleinen Igeltanrek Hier Erfahren sie alles wissenswerte über Echinops telfairi, den kleinen Igeltanrek. ... http://www.fmnh.helsinki.fi/users/haaramo/Metazoa/Deuterostoma/Chordata/Synapsida/Eutheria/Insectivora/Tenrecoidea.htm Tenrecoidea: M. ruwenzorii (ruwenzorinpikkusaukkopäästäinen) `--+o Tenrecinae (aitotanrekit) | |-- Echinops telfairi (telfairintanrekki, pikkusiilitanrekki ... http://www.fmnh.helsinki.fi/users/haaramo/Metazoa/Deuterostoma/Chordata/Synapsida/Eutheria/Eutheria_2.htm Placentalia after Waddell, Okada & Hasegawa 1999: Phylogenetic position of the tanrecs (Mammalia: Tanrecidae) of Madagaskar based on analysis of the complete mitochondrial genome sequence of Echinops telfairi. ... http://genstyle.imed.jussieu.fr/chaosgame/affichage_esp_list.php?lettres=e Alphabetical List of Species: Echinops ritro (3). Echinops sp (2). Echinops spinosissimus (2). Echinops telfairi (3). Echinops viscosus (2). Echinopsis chiloensis (1). Echinorhinus cookei (2). ... http://www.aya.or.jp/~sczoo/inventory/inventory-mammal.html 飼育動物一覧表「哺乳類ã€?: ...食虫目, テンレック科, ヒメãƒ?リテンレック, Echinops telfairi. ãƒ?リãƒ?ズミ科, マンシュウãƒ?リãƒ?ズミ, Erinaceus amurensis. ... http://www.zoo-ljubljana.si/pages/zivali/seznam.html ZOO - Ljubljana: VreÄ?arji, Marsupialia, rdeÄ?evrati kenguru, Macropus rufogriseus, 5/7/3. Žužkojedi, Insectivora, mali madagaskarski tenrek, Echinops telfairi, 2/2/1. Prvaki, Primates, ... http://www.zooplzen.cz/fauna/trida.php?id=1 Zoologická zahrada Plzeň: Binturong malajský (Arctitis binturong binturong). BodlÃn Telfairův (Echinops telfairi). Bodlinatka Ä?adská (Acomys cahirinus seurati). ... http://www.zooplzen.cz/fauna/oblast.php?id=4 Zoologická zahrada Plzeň: Alexandr malý (Psittacula krameri krameri). Antilopa losà (Taurotragus oryx). BodlÃn Telfairův (Echinops telfairi). Chameleon (Chamaeleo deremensis). ... http://bighost.area.ba.cnr.it/mitochondriome/Mt_chordata.htm Mt_Chordata: Insectivora. Talpa europaea, european mole, TEUY19192, Y19192, 16884. Echinops telfairi, small Madagascar hedgehog, ETE400734, AJ400734, 16555. ... http://www.paa2004.org/posters.htm Placenta Association of the Americas Conference 2004: Canada. Formation of the haemophagous zone of the Tenrec, Echinops Telfairi ¹ A Carter*, ²T Blankenship, ³H Künzle & ²A Enders. ... http://www.zwergigel.de/forum/thread.php?id=1061 Zwergigel - www.zwergigel.de - Jungs oder Mädchen?????: ...- ... Wäre ja mal toll wenn irgendjemand auch mal Echinops telfairi einer photographisch dokumentierten Geschlechtbestimmung unterzieht... :). ... http://sege.ntu.edu.sg/cgi-bin/extract_info.pl?dbase=gbmam&field=protein&pop=38&type=1 Your Search Results: 2,leng:111,8,sum:38) ,nucleotides(113..451) , product("aldolase A") DFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQ{N}G > 55624_ETE272234 Echinops telfairi partial cryaa ... http://www.gwdg.de/service/info-all/gen-sequenz/db_metazoa_mito_link.html mitochondriale Gensequenzen (Metazoen): Drosophila yakuba. Dugong dugon. Echinococcus multilocularis. Echinops telfairi. Echinosorex gymnura. Eigenmannia sp. Elassoma evergladei. Eleotris acanthopoma. ... http://www.blackwellpublishing.com/issue.asp?ref=0021-8782&vid=203&iid=3&oc=&s=&site=1 Journal of Anatomy Issue: View Abstract. 283-296 Zebrin II compartmentation of the cerebellum in a basal insectivore, the Madagascan hedgehog tenrec Echinops telfairi. ... http://www.savci.upol.cz/hmyzozra.htm Insectivora - Hmyzožravci: PodÄ?eleÄ?: bodlÃni ježkovità (Tenrecinae) - Hedgehog Tenrecs (syn. Tenrecs): Echinops telfairi Martin, 1838 - bodlÃn Telfairův (syn. ... http://plant.csr.miyakyo-u.ac.jp/php/search.php?zokumei=%A5%D2%A5%B4%A5%BF%A5%A4%C2%B0 oNLINEæ¤?物アルãƒ?ム～ 検索画é?¢ ～: ...別å??：ã?ªã?—. 2.エã‚ノプス・テルファイリ （0 件）, ã‚ク 科 ï¼? ヒゴタイ属, å¦å??：Echinops telfairi (Martin). 別å??：ã?ª ã?—. ... http://bioinf.man.ac.uk/ogre/searchresults.shtml?searchstring=%5BA-Za-z0-9%5C-%5D OGRe. search results: Dugong dugon dugong - mtDNA Echinosorex gymnura moonrat - mtDNA Echinococcus multilocularis fox and cat tapeworm - mtDNA Echinops telfairi small Madagascar ... http://www.calacademy.org/research/bmammals/afrotheria/systematics.html Afrotherian systematics: Ruwenzori otter shrew. Subfamily: Tenrecinae. Genus: Echinops. Species: Echinops telfairi. Lesser hedgehog tenrec. Genus: Hemicentetes. Streaked tenrecs. ... http://web.gc.cuny.edu/eeb/students/salton.html Justine A. Salton, PhD Program in Biology-EEB, Graduate Center ...: Beza Mahafaly Special Reserve in southwestern Madagascar, Echinops telfairi, the lesser hedgehog tenrec, Ranomafana National Park in the eastern highlands of ... http://www.unipv.it/bralweb/1992_prg.htm [an error occurred while processing this directive] Echinops telfairi [an error occurred while processing this directive] 40592 Lesser Hedgehog Tenrec, Small Madagascar "Hedgehog" Lesser Hedgehog Tenrec, Small Madagascar "Hedgehog" Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |