Encephalartos caffer - Eastern Cape Dwarf Cycad

IUCN Status: Near Threatened
IUCN Species Profile
Encephalartos caffer: Encephalartos caffer. Synonymy: Numerous; see The Cycad Pages, Distribution: South Africa. Common name: Eastern Cape dwarf cycad, Conservation status: Unknown. ...
http://www.plantapalm.com/vce/species/pics/seeds/encephalartos_caffer.htm

Encephalartos caffer seed: Encephalartos caffer. Synonymy: Numerous; see Ken Hill's The Cycad Pages, Distribution: Eastern Cape Province, South Africa. Common ...
http://www.botanik.uni-bonn.de/conifers/za/en/caffer.htm

Encephalartos caffer description: Encephalartos caffer (Thunb.) Lehm. Remarks. Single cones may weigh 90 pounds, the largest known (1). Citations. (1) Jones 1993. back ...
http://plantnet.rbgsyd.gov.au/cgi-bin/taxon.pl?name=Encephalartos+caffer

Encephalartos caffer: The Cycad Pages. Encephalartos caffer. Encephalartos caffer (Thunb.) Lehm., Pugill. 6: 14 (1834). ... Physiol. 4: 414, tt. 6 & 7 (1837-8). Encephalartos caffer var. ...
http://plantnet.rbgsyd.gov.au/cgi-bin/taxon.pl?name=Encephalartos+horridus

Encephalartos horridus: ...nud.] [Encephalartos brownei hort. ex J. Schust., Pflanzenr. 4(1): 117 (1932), nom. nud.] [Encephalartos caffer var. longifolia hort. ex J. Schust., Pflanzenr. ...
http://www.succulents.net/cycads/caffer/caffer.html

Cycad Society SA: Encephalartos caffer: Encephalartos caffer - (Thunb.) Lehmann. ... Do you have a photograph of Encephalartos caffer to put on this page? Please send it to Wynand van Eeden. ...
http://www.succulents.net/cycads/villosus/villosus.html

Cycad Society SA: Encephalartos villosus: It is now almost certain that this description was based on cone material from Encephalartos caffer - hence the name Zamia villosa has no botanical validity. ...
http://plantsdatabase.com/go/59753/

Plants Database: Detailed information on Eastern Cape Dwarf Cycad ...: Eastern Cape Dwarf Cycad Encephalartos caffer. Family: Cycadaceae Genus: Encephalartos (en-sef-uh-LAR-tos) (Info) Species: caffer (KAF-fer) (Info). ...
http://plantsdatabase.com/t/405675/

Plants Database: PDB Pictures: Eastern Cape Dwarf Cycad ...: Eastern Cape Dwarf Cycad (Encephalartos caffer). Forum: PDB Pictures, Total Replies: 0. Author, Content. palmbob Oct 23, 2003 8:49 AM. ...
http://search.metacrawler.com/crawler?general=Encephalartos+caffer&method=0

Search: Encephalartos caffer - MetaCrawler: Web search results for "Encephalartos caffer" (1 - 20 of 61). ... Refine Your Results. -, "encephalartos caffer"(61). -, Plants (8). encephalartos caffer (2). ...
http://search.metacrawler.com/crawler?general=Encephalartos+arenarius&method=0

Search: Encephalartos arenarius - MetaCrawler: Encephalartos arenarius. Encephalartos caffer. Encephalartos ... munchii. ... Encephalartos arenarius . Encephalartos arenarius blue . Encephalartos caffer ... ...
http://gardening.worldonline.co.za/0140.htm

Cycads: Cycads. Botanical Name: Encephalartos caffer Common Name: Cycad. Use : Outdoors Indigenous/Exotic : Indigenous Evergreen/Deciduous ...
http://gardening.worldonline.co.za/indigenousplants2.htm

Indigenous plants: Elegia capensis, Broom Reed. Encephalartos altensteinii, Eastern Cape Giant Cycad. Encephalartos caffer, Cycad. Encephalartos ferox, Zululand Cycad. ...
http://encephalartos_caffer.bluerider.com/wordsearch/encephalartos_caffer

encephalartos caffer - BlueRider.com: ...encephalartos caffer - listen | domain availability, Dictionary and Thesaurus entries for: encephalartos caffer. Your search results... ...
http://dict.die.net/encephalartos%20caffer/

encephalartos caffer - definition by dict.die.net: Definition: encephalartos caffer. Search dictionary for. Source: WordNet (r) 1.7 Encephalartos caffer n : South African cycad; the ...
http://www.yourdictionary.net/Encephalartos%20caffer.html

Encephalartos caffer - Dictionary Definition: Dictionary Definition of Encephalartos caffer. Click Here, The noun "Encephalartos caffer" has 1 senses. ...
http://www.yourdictionary.net/dir/E1750.html

Words beginning with E: ...encaustic | enceinte | Encelia | Encelia farinosa | Enceliopsis | Enceliopsis nudicaulis | encephalartos | Encephalartos caffer | encephalitis | encephalitis ...
http://directory.google.com/Top/Science/Biology/Flora_and_Fauna/Plantae/Cycadophyta/Cycadopsida/Zamiaceae/Encephalartos/Encephalartos_caffer/

Google Directory - Science > Biology > Flora and Fauna > Plantae > ...: Web. Encephalartos caffer, ... Encephalartos caffer - http://www.plantapalm.com/vce/species/encephalartos_caffer.htm Images. Encephalartos ...
http://directory.google.com/Top/Science/Biology/Flora_and_Fauna/Plantae/Cycadophyta/Cycadopsida/Zamiaceae/Encephalartos/

Google Directory - Science > Biology > Flora and Fauna > Plantae > ...: 2) Encephalartos arenarius (2) Encephalartos barteri (2) Encephalartos brevifoliolatus (2) Encephalartos bubalinus (3) Encephalartos caffer (3) Encephalartos ...
http://www.thefreedictionary.com/Encephalartos%20caffer

Encephalartos caffer definition of Encephalartos caffer. What is ...: Definition of Encephalartos caffer in the Dictionary and Thesaurus. Encephalartos caffer in Free online English dictionary and thesaurus ...
http://www.thefreedictionary.com/Encaustic%20tile

Encaustic tile definition of Encaustic tile. What is Encaustic ...: Encaustic tile. Word: Word. (Fine Arts), an earthenware tile which has a decorative pattern and is not wholly of one color. ...
http://hortiplex.gardenweb.com/plants/p1/gw1043205.html

Encephalartos caffer : kaffir bread: Encephalartos caffer kaffir bread. Species Record #: gw1043205. ... Add your comments and/or image on Encephalartos caffer, Links, Info, Image, Plants, Seeds. ...
http://hortiplex.gardenweb.com/plants/source_VCE_page1.html

Virtual Cycad Encyclopedia Links: ...cycad. [List All Plants in this Genus], [More Info], [Add Your Comments and/or Image]. Species: Encephalartos caffer, kaffir bread. [List ...
http://www.meemelink.com/prints%20pages/12969.Cycadaceae%20-%20Encephalartos%20caffer.htm

Cycadaceae - Encephalartos caffer: Cycadaceae - Encephalartos caffer - Encephalartos brachyphyllus. From: Flore des serres et des jardins de l’Europe by Charles Lemaire and others. ...
http://www.meemelink.com/prints%20pages/prints.Cycadaceae.htm

Cycadaceae: ...pp. 83-84; Hunt 689; Henrey 472; Stafleu & Cowan 1290. Cycadaceae - Encephalartos caffer - Encephalartos brachyphyllus. From: Flore ...
http://www.newcrops.uq.edu.au/listing/encephalartoscaffer.htm

encephalartoscaffer: Encephalartos caffer. Analysis of numbers of papers/mentions over time (Agricola database 1970-1996): Source: AGRICOLA database (1970-1996). ...
http://www.newcrops.uq.edu.au/listing/listingindexe.htm

listing index e: ...triticoides Embelia nagushia Embelia ribes Emblica officinalis see Phyllanthus emblica Emilia sonchifolia Empetrum nigrum Encephalartos caffer Enhalus koenigii ...
http://define.ansme.com/words/e/encephalartos_caffer.html

Encephalartos caffer - AnsMe.com Dictionary (define): Dictionary - Encephalartos caffer. ... Definition for Encephalartos caffer. Encephalartos caffer (noun) -. 1. South African cycad; the ...
http://define.ansme.com/words/e/encephalartos.html

encephalartos - AnsMe.com Dictionary (define): Search: Web Sites. ...
http://gmr.landfood.unimelb.edu.au/Plantnames/Sorting/Encephalartos.html

MMPND - Sorting Encephalartos names: Encephalartos arenarius RA Dyer; Encephalartos brevifoliolatus P. Vorster; Encephalartos caffer (Thunb.) Lehm. ... Encephalartos caffer (Thunb.) Lehm. ...
http://gmr.landfood.unimelb.edu.au/Plantnames/Sorting/Cycas.html

MMPND - Sorting Cycas names: ...ex Hook f. -> Cycas circinalis L. Cycas caffer Thunb. -> Encephalartos caffer (Thunb.) Lehm. Cycas caffra Thunb. -> Encephalartos caffer (Thunb.) Lehm. ...
http://www.family-movie-review.com/Science/Biology/Flora_and_Fauna/Plantae/Cycadophyta/Encephalartos_caffer/

»»Encephalartos caffer Movie Reviews««: Encephalartos caffer Movie Reviews. ... Family movie reviews for "Encephalartos caffer" sorted by average review score: Casper the Friendly ...
http://www.family-movie-review.com/Science/Biology/Flora_and_Fauna/Plantae/Cycadophyta/Encephalartos_caffer/Encephalartos_caffer_5.html

»»Encephalartos caffer Movie Reviews««: Encephalartos caffer Movie Reviews. ... Family movie reviews for "Encephalartos caffer" sorted by average review score: The Tracker. Released ...
http://cycadpalm.com/raplsp.html

Rare Plant Special!: Encephalartos caffer Plants 1.5 Inch Caudex Size Only 1 Available EnceCaff1.5 Regular price: $250.00 Sale price: $195.00. Encephalartos ...
http://cycadpalm.com/liofnewplav.html

List of New Plant Availabilities: ...and large plants) • Encephalartos arenarius (blue and green including large plants) • Encephalartos caffer • Encephalartos dyerianus • Encephalartos ...
http://www.kangaroolinks.com/Science/Biology/Flora_and_Fauna/Plantae/Cycadophyta/Cycadopsida/Zamiaceae/Encephalartos/Encephalartos_caffer/

kangaroolinks.com: Science/Biology/Flora and Fauna/Plantae ...: This category is for Encephalartos caffer and is part of the Science: Biology: Flora and Fauna: Plantae: Cycadophyta: Cycadopsida: Zamiaceae: Encephalartos ...
http://www.cbel.com/cycadophyta/

Cycadophyta - 502 of the best sites selected by humans: ...- ... Encephalartos bubalinus -Encephalartos bubalinus -Encephalartos bulbalinus Cycadopsida Encephalartos_caffer -Encephalartos caffer -Encephalartos caffer ...
http://nature.jardin.free.fr/arbuste/ft_encephalartos_hil.html

Cycas (Encephalartos hildebrandtii): ...- ... entre 2 arrosages NB Autres espèces : Encephalartos altensteinii H jusqu'à 6 m (photo du haut) Encephalartos arenarius (photo) Encephalartos caffer H 1 m ...
http://nature.jardin.free.fr/sp/ft_encephalartos_hil.html

Cycas (Encephalartos hildebrandtii): ...- ... entre 2 arrosages NB Autres espèces: Encephalartos altensteinii H jusqu'à 6 m (photo du haut) Encephalartos arenarius (photo) Encephalartos caffer H 1 m ...
http://www.sunshine-seeds.de/cycadaceae/foto_encephalartos.htm

Foto_ Encephalartos: ...- ... Encephalartos bubalinus female. Encephalartos bubalinus male. Encephalartos caffer. Encephalartos cerinus. Encephalartos cerinus. Encephalartos concinus. ...
http://www.jdandersen.com/id8_m.htm

Cycads - No Summary: ...- ... Encephalartos arenarius. Encephalartos bubalinus. $600.00. Encephalartos caffer. $75.00. $150.00. Encephalartos cerinus. Encephalartos chiwala hills. $50.00. ...
http://www.arbolesornamentales.com/Zamiaceae.htm

FAMILIA ZAMIACEAE: ...- ... Encephalartos altensteinii Lehm. Encephalartos caffer (Thunb.) Lehm. Encephalartos ferox Bertol. Encephalartos hildebrandtii A.Br. ...
http://www.cycad.org/Photos/photos.htm

The Cycad Society Photos Page: E_arenarius1.jpg Encephalartos arenarius. E_caffer3.jpg Encephalartos caffer. E_concinnus.jpg Encephalartos concinnus. E_dyerianus.jpg Encephalartos dyerianus. ...
http://www.cycads-n-palms.com/minimumtemperatures2.html

Palms & Cycads,Cycads for sale,Palms for sale: Encephalartos aemulans - 24°F. Encephalartos arenarius - 25°F. Encephalartos caffer - 29°F. Encephalartos ferox - 26°F. Encephalartos gratus - 28°F. ...
http://www.websters-dictionary-online.org/definitions/english/en%5CEncephalartos_caffer.html

Encephalartos Caffer: Copyright © Philip M. Parker, INSEAD. Terms of Use. Encephalartos Caffer. Definition: Encephalartos Caffer. Encephalartos Caffer. Noun. ...
http://www.websters-dictionary-online.org/definitions/english/en%5Cencephalartos.html

Encephalartos: All rights reserved. Crosswords: Encephalartos. English words defined with "encephalartos": Encephalartos caffer ♦ genus Encephalartos. (references). ...
http://www.biologie.uni-hamburg.de/b-online/library/cycads/photos.htm

Virtual Cycad Encyclopedia: Photo Gallery: ...trispinosa; Encephalartos arenarius; Encephalartos arenarius X ferox; Encephalartos bubalinus; Encephalartos caffer; Encephalartos cerinus; ...
http://wiki.brambring.nl/wiki/Main/PalmenMinimum

Main - Palmen Minimum - brambring.nl: Encephalartos aemulans, -4, Encephalartos altensteinii, -3, Encephalartos arenarius, -4, Encephalartos caffer, -2, Encephalartos ferox, -3, Encephalartos gratus, -2, ...
http://www.lotusland.org/catalogaz/ej.html

Lotusland Plant Collections: Encephalartos bubalinus, Zamiaceae, Tanzania. Encephalartos caffer, Zamiaceae, South Africa. Encephalartos chimanimaniensis, Zamiaceae, Mozambique, Zimbabwe. ...
http://www.lotusland.org/catalog/catalogPage40.html

catalog web: ...- ... Ceratozamia beccarae, Encephalartos bubalinus. Ceratozamia hildae, Encephalartos caffer. Ceratozamia kuesteriana, Encephalartos chimanimaniensis. ...
http://131.220.103.1/conifers/topics/big_index.htm

Gymnosperm Database complete taxonomic index: ...- ... aplanatus. Encephalartos barteri, Encephalartos brevifoliolatus, Encephalartos bulbalinus, Encephalartos caffer. Encephalartos cerinus, ...
http://www.speciesaccounts.org/Seed%20plants.htm

Seed plants: ...- ... Encephalartos brevifoliolatus. Encephalartos bubalinus. Encephalartos caffer. Encephalartos cerinus. Encephalartos chimanimaniensis. Encephalartos concinnus. ...
http://www.virtualherbarium.org/vh/auth/cycad.html

FTG AUTHORITY FILE FOR CYCAD NAMES: ...ex Miq. Encephalartos brevifoliolatus Vorster Encephalartos bubalinus Melville Encephalartos caffer (Thunb.)Lehm. Encephalartos ...
http://www.br.fgov.be/RESEARCH/COLLECTIONS/LIVING/LIVCOL/l_zamiac.html

National Botanic Garden of Belgium : Living Plant Collections: Encephalartos altensteinii Lehm. Encephalartos arenarius RA.Dyer, Encephalartos caffer (Thunb.) Lehm. [South Africa]. Encephalartos concinnus RA.Dyer & I.Verd. ...
http://www.hyperdictionary.com/dictionary/genus+Encephalartos

GENUS ENCEPHALARTOS - Meaning and Definition of the Word: See Also: encephalartos, Encephalartos caffer, family Zamiaceae, gymnosperm genus, kaffir bread, zamia family, Zamiaceae. COPYRIGHT © 2000-2003 WEBNOX CORP. ...
http://www.hyperdictionary.com/dictionary/cycad

CYCAD - Meaning and Definition of the Word: See Also: burrawong, ceratozamia, Cycas revoluta, dioon, encephalartos, Encephalartos caffer, gymnosperm, kaffir bread, macrozamia, Macrozamia communis ...
http://www.webster-dictionary.net/definition/cycad

Definition of Cycad by Webster's Dictionary: ...burrawong, ceratozamia, Cycas revoluta, dioon, encephalartos, Encephalartos caffer, gymnosperm, kaffir bread, macrozamia, Macrozamia communis, Macrozamia ...
http://www.homolaicus.com/scienza/erbario/utility/botanica_sistematica/hypertext/0636.htm

BOTANICA SISTEMATICA: ...- ... aplanatus; Encephalartos arenarius; Encephalartos barteri; Encephalartos brevifoliolatus; Encephalartos bubalinus; Encephalartos caffer; Encephalartos cerinus ...
http://home.earthlink.net/~wccshome/photosindex.htm

West Coast Cycad Society Pics Page: Encephalartos arenarius . Encephalartos arenarius . Encephalartos arenarius blue . Encephalartos caffer . Encephalartos concinnus . Encephalartos cupidus . ...
http://www.krugosvet.ru/articles/02/1000200/1000200a1.htm

СÐ?ГОВÐ?ИКОВЫЕ: Ñ?ущеÑ?твовавшие когда-либо на Ñ?вете, дает африканÑ?кий Ñ?аговник Encephalartos caffer: маÑ?Ñ?а одной ...
http://www.wauu.de/Science/Biology/Flora_and_Fauna/Plantae/Cycadophyta/Cycadopsida/Zamiaceae/Encephalartos/

Wauu.DE: Science: Biology: Flora and Fauna: Plantae: Cycadophyta ...: Encephalartos brevifoliolatus (2). Encephalartos bubalinus (3). Encephalartos caffer (3). Encephalartos cerinus (3). Encephalartos concinnus (2). ...
http://www.winternet.com/~chuckg/dictionary/dictionary.63.html

Botanical Epithets:caelestinus-cajanoides: Africa. caffer, caffr, adj, kafir Arabic unbeliever, pagan. Encephalartos caffer (Thunb.) Lehm. Aberia caffra Hook. f. & Harvey Combretum caffrum (Eckl. ...
http://www.factophile.com/Plant_Kingdom/Plants_as_Food/plant08pf.htm

Factophile.com :: Plant Kingdom :: Plants as Food :: Starch Crops: American cabbage palm, Oreodoxa oleraceae, Palmae. kaffir bread, Encephalartos caffer, Zamiaceae. bread tree, E. altensteinii, Zamiaceae. maize, Zea mays, Gramineae. ...
http://www.travelafricamag.com/community.php?id=43

Travel Africa: ...is perhaps not so surprising given that cycads produce the largest cones in living plants – one African specimen, from Encephalartos caffer, weighed over 41kg ...
http://www.endangeredspecies.com/text/Cycads/descriptions.htm

BOWENIA SERRULATA: Dave Gordon has a plant in S.California which grew to 3' high in 7 years. ENCEPHALARTOS CAFFER 3' height, Sun, 33 degrees F Minimum, . ...
http://food.oregonstate.edu/glossary/e.html

GLOSSARY, DICTIONARY, Food Resource [http://food.oregonstate.edu ...: ...empanadas empanadas Empetrum Nigrum emulsifier emulsion emulsification en gelee encapsulate encapsulated encenilla Encephalartos Caffer enchiladas endive ...
http://www.yellowpages.pl/ca/253688/Encephalartos_caffer/

Encephalartos caffer Polish Yellow Pages - Polska - Poland - Polen: Encephalartos_caffer. Encephalartos caffer- Images. Encephalartos caffer- Encephalartos caffer; Encephalartos caffer- Encephalartos caffer. ...
http://www.lysator.liu.se/runeberg/nfag/0796.html

1579-1580 (Nordisk familjebok / 1800-talsutgåvan. 7. Hufvudskål ...: Print (PDF) - On this page / på denna sida - Kaffer-bröd benämns ett slags bröd, beredt af märgen hos Encephalartos Caffer Miqv., en cycadé i Kaplandet ...
http://www.ihar.edu.pl/gene_bank/Gardens/Lodz/ptob.html

Ogród Botaniczny w Å?odzi: ...uwagÄ™ zasÅ‚ugujÄ… również sagowce Cycadinae, które w łódzkiej Palmiarni reprezentowane sÄ… przez 5 gatunków: Encephalartos caffer, Cycas revoluta i ...
http://www.realdictionary.com/E/En.asp

English Dictionary - Displaying all words starting with En: ...enarthrosis enatic Enbrel encamp encapsulate encase encasement enceinte Encelia farinosa Enceliopsis nudicaulis Encephalartos caffer encephalitis lethargica ...
http://www.nuclear-diagnostics.com/Science/Biology/Flora_and_Fauna/Plantae/Cycadophyta/Cycadopsida/Zamiaceae/Encephalartos/Encephalartos_caffer/

nud: Science/Biology/Flora and Fauna/Plantae/Cycadophyta ...: Links: Encephalartos caffer Images. ... Encephalartos caffer http://www.botanik.uni-bonn.de/conifers/za/en/caffer.htm. More search options. ...
http://www.terra-typica.ch/boerse/flora/sub07.htm

TERRA TYPICA - PFLANZEN-BÖRSE: ...- ... 03/01/02 13:03:53 - Nachricht #12. VON: LMP.Cockle /. Cycas siamensis seedling £20 Encephalartos caffer £150 aprox 10 leaves - rare! ...
http://www.itis.usda.gov/servlet/SingleRpt/RefRpt?search_type=expert&search_id=expert_id&search_id_value=83

ITIS 'Expert(s)' Search results for John H. Wiersema, Ph.D.: Elaphoglossum spatulatum (Bory) T. Moore -- accepted. Encephalartos Lehm. -- accepted. Encephalartos caffer (Thunb.) Lehm. -- accepted. Enhalus Rich. -- accepted. ...
http://www.itis.usda.gov/servlet/SingleRpt/RefRpt?search_type=author&search_id=author_id&search_id_value=43390

ITIS 'Taxon Author(s)' Search results citing "Thunb.": Elsholtzia ciliata (Thunb.) Hyl. -- accepted -- crested late-summer-mint, crested latesummer mint. Encephalartos caffer (Thunb.) Lehm. -- accepted. ...
http://can.epicdb.com:81/w-driver-epicdbcom81-can.html?w=driver+download

EPICdb.com - advanced cardiac life supportdivision of child ...: Them their disassembled golf driver following are. My encephalartos caffer compaq driver doing. Encoded separating downloads driver free scattering shear. ...
http://www.capenature.org.za/permits/html/flora.html

Flora Permits: Cycad seedlings are any species of Cycad with a stem diameter less than 15 centimetres, other than the following species: Encephalartos caffer, E. cerinus, E ...
http://www.webster-dictionary.org/definition/encephalogram

encephalogram - Definition of encephalogram by Webster-Dictionary. ...: ...tile Encave Enceinte Encelia Encelia farinosa Enceliopsis Enceliopsis nudicaulis Encenia Encense encephalartos Encephalartos caffer Encephalic Encephalitis ...
http://www.webster-dictionary.org/definition/encephalon

encephalon - Definition of encephalon by Webster-Dictionary.org: Browse. Enceliopsis nudicaulis Encenia Encense encephalartos Encephalartos caffer Encephalic Encephalitis encephalitis lethargica Encephalocele encephalogram ...
http://listarchive.cinjug.org/html/directors/2003-12/msg00019.html

EB AY <nervus ischiadicus> News: ...disseminated lupus erythematosus atomic number 68 genus fungia australian cockroach tube wrench nut butter pansy orchid encephalartos caffer betula pubescens ...
http://virtual.cvut.cz/kifb/wordnet/_flowering_plant.html

Related WordNet synsets for SUMO concept FloweringPlant: Cycadaceae genus Encephalartos genus of arborescent African cycads; sometimes classified in family_Cycadaceae kaffir bread, Encephalartos caffer South African ...
http://ct_x.tripod.com/crdb/crdbcycs.html

Coldhardy Cycad Species: ...medium 25'F 27'F 29'F Encephalartos aemulans Africa little Encephalartos altensteinii E.Cape to Mozambique little 26'F Encephalartos caffer Africa little ...
http://www.geocities.com/jalethbridge/LosGatosPlants_OtherUKBotanicGardenCycads.html

LosGatosPlants_OtherUKBotanicGardenCycads: ...mejiae Dioon spinulosum Encephalartos altensteinii Encephalartos altensteinii x trispinosus Encephalartos bubalinus Encephalartos caffer Encephalartos ferox ...
http://yoohoo.euweb.cz/cantor2004/aktual/aktual6/cykasy.html

cykasy: Původem jsou ve StÅ™ední a Jižní Americe. Podobné druhy: Encephalartos caffer z jižní Afriky má kmen až 3 m vysoký (Ä?ásteÄ?nÄ› se ukrývá v zemi). ...
http://www2.junglemusic.net/New/cycadproducts-seedlings.asp

Large Cycads For Sale - Jungle Music Palms & Cycads: Encephalartos arenarius (blue form)*. inquire. Encephalartos bandula. $ 45+. Encephalartos caffer. Encephalartos cerinus. $ 95+. Encephalartos chimanimaniensis. $ 85+. ...
http://www.highindex.com/Science/Biology/Flora_and_Fauna/Plantae/Cycadophyta/Cycadopsida/Zamiaceae/Encephalartos/

High Index - Science: Biology: Flora and Fauna: Plantae ...: Category: Search Engine Directory / Science / Biology / Flora and Fauna / Plantae / Cycadophyta / Cycadopsida / Zamiaceae / Encephalartos ...
http://search.freefind.com/find.html?id=5003249&map=0&page=1&lang=en

Virtual Cycad Encyclopedia Site Map: Virtual Cycad Encyclopedia Site Map! Page: [Prev] 1 2 [Next]. Encephalartos arenarius X ferox; Encephalartos bubalinus; Encephalartos caffer; Encephalartos cerinus; ...
http://groups.yahoo.com/group/exoten/message/10837

Yahoo! Groups : exoten Messages : Message 10837 of 19941: 32.30 266.00 And in a few weeks, we will receive: Encephalartos altensteinii Each $ 3.96 33.00 78.38 300.00 ---- Encephalartos caffer DECEMBER Encephalartos ...
http://groups.yahoo.com/group/cycad/message/5735

Yahoo! Groups : cycad Messages : Message 5735 of 15849: I was in > search of Encephalartos caffer at the type locality and was asking the local > rangers in the reserve where they occurred, "Can you tell me where ...
http://encyclopedia.thefreedictionary.com/Encaustic%20painting

Encaustic painting - encyclopedia article about Encaustic painting ...: Encaustic painting. Word: Word. Encaustic painting, also called "hot wax painting", involves using ...
http://encyclopedia.thefreedictionary.com/Encephalopathy

Encephalopathy - encyclopedia article about Encephalopathy. Free ...: Encephalopathy. Word: Word. Encephalopathy refers to any of several brain diseases. The most famous ...
http://relations.ansme.com/words/e/encephalartos_caffer.html

Encephalartos caffer - AnsMe.com Dictionary (relations): Dictionary - Encephalartos caffer. Show Definition. Sounds Similar. Relations. Rhymes. Translate. Relations for Encephalartos caffer. ...
http://genome.nhgri.nih.gov/histones/interfaces/browse.cgi?CATEGORY=H3&ORGANISM=ALL&NR=ALL&PARTIAL=ALL&EVENT=DISPLAY_FASTA_RESULTS

Framework Generated HTML -- Histones: PKDIQLARRIRGERA >gi|543556|pir|C61286 histone H3 - cycad (Encephalartos caffer) (fragment) ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL >gi|224865|prf ...
http://medical-dictionary.thefreedictionary.com/Encaustic+painting

Encaustic painting definition of Encaustic painting. What is ...: ...encyclopedia - dictionary home page, Dictionaries: General, Computing, Medical, Legal, Encyclopedia, Encaustic painting. Word: Word. ...
http://legal-dictionary.thefreedictionary.com/Enceinte

[an error occurred while processing this directive] Encephalartos caffer [an error occurred while processing this directive] 41929
Eastern Cape Dwarf Cycad Eastern Cape Dwarf Cycad

Home | Search | About


Copyright SpeciesList.com 2003-2009