|
|
Gazella bennettii - Chinkara, Indian Gazelle, Gazelle De L'indeIUCN Status: Least ConcernIUCN Species Profile http://212.187.155.84/pass_06june/subdirectories_for_search/SpeciesKingdoms/0Families_ACrM_Artiodactyla/Bovidae/Gazella/Gazella_bennettii/Gazella_bennettii.html Gazella bennettii - Indian gazelle (Species Link Page): SPECIES LINK PAGE. Gazella bennettii - Indian gazelle: Summary Information. Living Organisms / Animalia / Craniata / Mammalia / Artiodactyla ... http://212.187.155.84/pass_06june/subdirectories_for_search/SpeciesKingdoms/0Families_ACrM_Artiodactyla/Bovidae/Gazella/Gazella.htm Gazella - (Genus): Species. Gazella arabica - (Link page only); Gazella bennettii - Indian gazelle (Link page only); Gazella bilkis - (Link page only); Gazella ... http://www.natureportfolio.com/mammals/artiodactyls.php Nature Portfolio - catalogue of photos of even-toed ungulates: Thomson's Gazelle, Gazella thomsonii. Indian Gazelle (Chinkara), Gazella bennettii. Springbok, Antidorcas marsupialis. Gerenuk, Litocranius walleri. ... http://www.montereybay.com/creagrus/bigbustards.html The big bustards: The first one was actually flushed by a pack of feral dogs that were harassing Indian Gazelles Gazella bennettii, known locally as Chinkara. ... http://www.montereybay.com/creagrus/India2001list.html India 2001 trip list: WATER BUFFALO ** [ph] Common & easily seen in Kaziranga NP which is one of the last strongholds of this beast in the wild Gazella bennettii INDIAN GAZELLE ... http://www.worldwildlife.org/wildworld/profiles/terrestrial/im/im1303_full.html Terrestrial Ecoregions -- Northwestern thorn scrub forests (IM1303 ...: ...exceptionally species-rich nor high in endemism, the ecoregion nevertheless harbors viable populations of chinkara (Gazella bennettii), chousingha (Tetracerus ... http://www.worldwildlife.org/wildworld/profiles/terrestrial/im/im0901_full.html Terrestrial Ecoregions -- Rann of Kutch seasonal salt marsh ...: ...harbors several charismatic mammal species of conservation importance, including the Asiatic wild ass, chinkara (Gazella bennettii), nilgai (Boselaphus ... http://www.nickgarbutt.com/stock_photos/mammals.htm Mammal Photos of Madagascar Africa and India: Bos gaurus) · Asian Water Buffalo (Bubalus arnee) · Nilgai (Boselaphus tragocamelus) · Indian Gazelle or Chinkara (Gazella bennettii) · Blackbuck (Antilope ... http://animaldiversity.ummz.umich.edu/site/accounts/information/Gazella.html ADW: Gazella: Classification: ...arabica (Arabian gazelle). Species Gazella bennettii (Indian gazelle). Species Gazella bilkis (Queen Of Sheba's gazelle). Species Gazella ... http://utne.nvg.org/g/bovidae.html Skrivarstuå: Fe (Bovidæ): Antilope cervicapra - hoe, ung hanne. eldre hanne (svartbukk). Gazella bennettii (Indian gazelle); Gazella cuvieri (Cuvier’s gazelle); Gazella dama (Dama gazelle): ... http://www.itis.usda.gov/servlet/SingleRpt/SingleRpt?search_topic=TSN&search_value=624969 ITIS Standard Report Page: Gazella: Direct Children: Species, Gazella arabica (Lichtenstein, 1827) -- Arabian gazelle, Species, Gazella bennettii (Sykes, 1831) -- Indian gazelle, ... http://www.itis.usda.gov/servlet/SingleRpt/RefRpt?search_type=expert&search_id=expert_id&search_id_value=110 ITIS 'Expert(s)' Search results for Peter Grubb: Gazella arabica (Lichtenstein, 1827) -- valid -- Arabian gazelle. Gazella bennettii (Sykes, 1831) -- valid -- Indian gazelle. Gazella ... http://perso.club-internet.fr/boudetjo/ZooList/Mammif/NewSpec.html Nouvelles espèces: Statut. Cephalophus rufilatus rubidior, Kingdon, 1997, Congo, Gazella bennettii karamii, Jaffar Shikari 1993, Northeastern Iran, Jebeer, ... http://perso.club-internet.fr/boudetjo/ZooList/Mammif/ClasArti.html Classification des Artiodactyles: ...- ... Procapra Raphicerus Saiga, Ammodorcas clarkei Antidorcas marsupialis Antilope cervicapra Dorcatragus megalotis Gazella arabica Gazella bennettii Gazella bilkis ... http://biodiversity.iucnp.org/SpeciesMain.htm Biodiversity Programme - IUCN Pakistan: 14, Sand Cat, Felis margarita. 15, Chinkara, Gazella bennettii. 16, Goitred Gazelle, Gazella subgutturosa. 17, Striped Hyaena, Hyaena hyaena. 18, Common Otter, Lutra lutra. ... http://biodiversity.iucnp.org/MammalsOfPak.htm Biodiversity Programme - IUCN Pakistan: Balckbuck; Gazella subgutturosa – Goitred Gazelle or Persian Gazelle; Gazella bennettii – Chinkara or India Gazelle; Naemorhedus ... http://www.deer.rr.ualberta.ca/library/taxonomy/Artiodactyla.html Artiodactyla: Antidorcas marsupialis - Springbok Antilope cervicapra - Blackbuck Dorcatragus megalotis Gazella arabica - Arabian gazelle Gazella bennettii Gazella bilkis ... http://home.no.net/trohi/mammalia/artiodactyla/bovidae.html bovidae.html: ..., Gazella arabica, ¥¥¥??Arabian gazelle. ", Gazella bennettii, Indiagaselle=Indian gazelle(Chinkara)/Tidligere G. dorcas bennettii. ... http://zcog.org/zcog%20frames/library_captivity_files/Bovidae/bovidae.htm Bovidae: ...- ... Antílope Beira. Gazella arabica. Gacela arabe. Gazella bennettii G. dorcas bennettii. Chinkara o gacela india III Pakistan. Gazella bilkis. Gacela de Yemen. ... http://www.nih.go.jp/yoken/genebank/MNCb/seq5/MNCb-0886.BLA BLASTN 2.0a2MP-WashU [20-Oct-1996] [Build 22:58:53 Oct 20 1996] ...: 1122 1.2e-44 1 OM|AF030480||| AF030480 Gazella bennettii cytochrome oxid... ... 1115 2.5e-44 1 OM|AF030479||| AF030479 Gazella bennettii cytochrome oxid... ... http://www.ergo-light.com/ERGO/CGI/prot.cgi?prot=RCY12508&user= Protein Page for RCY12508 from Synechocystis sp. PCC6803: ...cervicapra, pirnr|NF00202956, 5.48e-12, 251, 65, Cytochrome c oxidase polypeptide III (EC 1.9.3.1), Gazella bennettii, pirnr|NF00202957, ... http://www.iraniancheetah.org/cheetah.htm Iranian Cheetah Society (ICS): ...shown that the main prey species for the Iranian cheetah is wild sheep Ovis orientalis, wild goat Capra aegagrus, Jebeer gazelle Gazella bennettii and Persian ... http://www.ultimateungulate.com/Artiodactyla.html Artiodactyla: Antilope Antilope cervicapra Blackbuck Dorcatragus Dorcatragus megalotis Beira Gazella Gazella arabica Arabian gazelle Gazella bennettii Indian gazelle Gazella ... http://fr.wikipedia.org/wiki/D%C3%A9sert_du_Thar Désert du Thar - Wikipédia: ...- ... Parmi les mamifères, on note l'antilope pallas (Antilope cervicapra), la chinkara ou gazelle d'Arabie (Gazella bennettii), le lynx caracal (Felis caracal) et ... http://www.panda.org/about_wwf/where_we_work/ecoregions/global200/pages/regions/region055.htm WWF - Global 200: ...leopard (Panthera pardus); blackbuck (Antilope cervicapra); chinkara (Gazella bennettii). General Threats: Degradation of forests due ... http://www.panda.org/about_wwf/where_we_work/ecoregions/global200/pages/regions/region033.htm WWF - Global 200: ...leopard (Panthera pardus); blackbuck (Antilope cervicapra); chinkara (Gazella bennettii). Species such as. crested serpent-eagle (Spilornis ... http://www.hindunet.org/hindu_history/sarasvati/dictionary/6717TO.HTM 6717: Image: deer: posta axis maculatus; bhot.-ret jel gazella bennettii (Santali.lex.) po_tu goat (Kod..); po_ta, ho_ta, ho_tu, ho_ntu he-goat (Ka.)(DEDR 4586). ... http://www.phthiraptera.org/Mammals/Bovidae.html Mammals: Bovidae: Tricholipeurus longiceps (Rudow, 1866) *. Gazella bennettii (Sykes, 1831) - Indian Gazelle; Gazella bilkis Groves and Lay, 1985 - Queen of Sheba´s Gazelle; ... http://www.peopleandplanet.net/doc.php?id=1863 peopleandplanet.net > biodiversity > features > desert wetlands to ...: ...hyaena (Hyaena hyaena) desert cat (Felis lybica), caracal (Felis caracal), honey badger (Mellivora capensis), chinkara (Gazella bennettii), nilgai (Boselaphus ... http://www.markuskappeler.ch/tex/texs/asiatischerloewe.html Asiatischer Löwe: ...- ... Cervus unicolor), Wildschweine (Sus scrofa), Nilgauantilopen (Boselaphus tragocamelus), Indische Gazellen (Gazella bennettii), Vierhornantilopen (Tetracerus ... http://www.janmanch.org/newsletter/getdetails.asp?id=96 Janmanch.org - Newsletter: It shares its short grass plains with Blackbuck Antilope cervicapra, Chinkara Gazella bennettii, Nilgai Boselephus tragocamelus, Wolf Canis lupus, Fox Vulpes ... http://indybirder.tripod.com/india4.html Indybirder: Birding the Backpacker Trail: The photo below is of a "Blue Bull", or male Nilgai, taken at Ranthambor. Chinkara/Indian Gazelle, Gazella bennettii Small numbers at Ranthambor. ... http://www.savci.upol.cz/sudokop.htm Artiodactyla - Sudokopytníci: ...sasin) - blackbuck. + Gazella arabica (Lichtenstein, 1827) - gazela arabská - Arabian gazelle Gazella bennettii (Sykes, 1831) - gazela indická (syn. ... http://www.bluewaterbiggame.com/game/asian_kennion_gazelle.cfm kennion gazelle hunting - BlueWaterBigGame.com: Big Game Books BWBG Books Song Of The Summits. Kennion Gazelle Hunting. hunting kennion gazelle - 06-05-2004. Kennion Gazelle. (Gazella bennettii fuscifrons). ... http://www.downtoearth.org.in/new_letter.asp?foldername=19980731&sec_id=1 DOWN TO EARTH: The Worldwatch report says that the Chinkara or the Indian Gazelle Gazella bennettii is an endangered species. But this is not so. ... http://www.blackwell-synergy.com/links/doi/10.1111/j.0021-8901.2004.00897.x/full/&favorite=add Modelling habitat selection and distribution of the critically ...: Wild large herbivorous mammals in our study sites were chinkara Gazella bennettii (Sykes), chital Axis axis (Erxleben) and black-naped hare Lepus nigricollis ... http://www.wildlifeofpakistan.com/ungulates_agd.html Antelope, Gazelle and Deer of Pakistan: These will be released in the wild in the near future. Chinkara or Indian Gazelle. ( Gazella Bennettii ). PHOTO CREDIT: WWF-Pakistan. Local name: Hiran (Urdu) ... http://www.soe.ucsc.edu/research/compbio/yeast-protein-predictions/Q027/Q0275/Q0275.t2k.pa.html a2m2html output for file tmp.a2m: ...gi|6166023sp|O48346|COX3_GAZGA_3:260 Cytochrome c oxidase polypeptide III; gi|2731936|gb|AAB93618.1| cytochrome oxidase subunit III [Gazella bennettii]; ... http://www.ncbi.org.in/threatenedfauna.html THREATENED INDIAN FAUNA: EN A2ce, B1+2cd, C2a, LR/nt. 43. Funambulus tristriatus. Western Ghats Squirrel. LR/nt. LR/nt. 44. Gazella bennettii. Chinkara. LR/cd. LR 1c. 45. Globicephala macrorhynchus. http://www.surfbirds.com/mb/trips/india-0402-rb.html birdwatching trip report - India - surfbirds.com: Boselaphus tragocamelus fairly common Ranthambhore, few at Bharatpur Blackbuck, Antilope cervicapra 20+ Devpura Chinkara, Gazella bennettii 2 Ranthambhore ... http://www.surfbirds.com/mb/Trip%20Reports/india-jol.html Birdwatching in India including Bharatpur, Ranthambor and Kosi ...: Nilgai, Boselaphus tragocamelus Common at Keoladeo Ghana NP and Ranthambor. Chinkara/Indian Gazelle, Gazella bennettii Small numbers at Ranthambor. ... http://144.16.65.194/hpg/envis/doc1999ahtml/biodmamal200414.html Mammals of India: 78. Funambulus sublineatus (Waterhouse) -- DD 79. Gazella bennettii (Sykes) -- LRlc 80. Gerbillus gleadowi (Murray) -- LRlc 81. ... http://srs.sanger.ac.uk/srs5bin/cgi-bin/wgetz?-id+2keC41M_g7t+%5Bswissprot-AccNumber:O48346%5D+-e Entry Page: 3.1). Gene name(s), mtco3 or coiii. Organism source, Gazella gazella (Mountain gazelle), and Gazella bennettii (Chinkara). Organism ... http://www.birdquest.co.uk/trip_reports_detail.cfm?ReportID=327 Birdquest, Trip Report: Sambar Cervus unicolor. Nilgai (Blue Bull) Boselaphus tragocamelus. Indian Gazelle (Chinkara) Gazella bennettii. Northern Palm Squirrel Funambulus pennantii. ... http://www.naturesafariindia.com/india-wildlife-species/ Ranthambore National Park,Ranthambore Wildlife Park,Ranthambhor ...: Hare Indian Hare (Lepus nigricollis)Khargosh Antelopes, Gazelles Indian Gazelle (Gazella bennettii) Chinkara Black Buck (Antelope Cervicapra ) Kala Hiran (Seen ... http://nema.cap.ed.ac.uk/nematodeESTs/Ascaris/Ascaris250-299/Asmc-283xnr.html National Center for Biotechnology Information (NCBI) Welcome to ...: ...- ... Sbjct: 143 SITWAHHSLMEGDRKHMIQALSITIALGVYFTLLQASEYYEAPFTISDGVYGSTF 197 gb|AAB93618.1| (AF030479) cytochrome oxidase subunit III [Gazella bennettii] >gi|2731938 ... http://www.bubo.co.uk/triprpts/india_03.htm Birding Trip Report to India 1999: Golden Jackal Canis aureus Common at Keoladeo Ghana; Chinkara (Indian Gazelle) Gazella bennettii Two just south of the Sawai Madhopur road near Ranthambhor on 21 ... http://www.bubo.co.uk/triprpts/india_05.htm Birding Trip Report to Rajasthan, India; February - March 2000: Up to 10 almost daily at KNP with just two singles at Ranthambore. * Chinkara (Indian Gazelle) Gazella bennettii. 2 at Ranthambore on 8. ... http://www.swbic.org/origin/proc_man/Blast/tutorial_blastnresult.html Results for RID 982950102-5377-6365: 50 7e-04 gi|2731869|gb|AF030614.1|AF030614 Gazella bennettii cytochr... 50 7e-04 gi|2731867|gb|AF030613.1|AF030613 Gazella bennettii cytochr... ... http://www.esapubs.org/archive/ecol/E084/094/MOMv3.3.txt AF extant Artiodactyla Bovidae Addax nasomaculatus 4.85 70000.3 60 ...: ...- ... Gazella subgutturosa 4.45 28500 91 EA extant Artiodactyla Bovidae Gazella gazella 4.36 23000 115 EA extant Artiodactyla Bovidae Gazella bennettii 4.28 18916.7 ... http://genoma.unsam.edu.ar/projects/tca/blast_dir/nr/tca-05c3.b1.br BLASTX 2.1.3 [Apr-1-2001] Reference: Altschul, Stephen F., Thomas ...: 258 >sp|O48346|COX3_GAZGA CYTOCHROME C OXIDASE POLYPEPTIDE III gb|AAB93618.1| (AF030479) cytochrome oxidase subunit III [Gazella bennettii] gb|AAB93619.1 ... http://genoma.unsam.edu.ar/projects/tca/blast_dir/nr/tca-01l10.b1MT.br BLASTX 2.1.3 [Apr-1-2001] Reference: Altschul, Stephen F., Thomas ...: 257 >sp|O48346|COX3_GAZGA CYTOCHROME C OXIDASE POLYPEPTIDE III gb|AAB93618.1| (AF030479) cytochrome oxidase subunit III [Gazella bennettii] gb|AAB93619.1 ... http://www.rickertweb.com/~justin/School/CS360%20Database%20Systems/PC4/Data/TAXON/HOOVES.txt ME MYPARENT RORDER NAME TAXON PRINTNAME AUTHOR CITATION COMMON_NM ...: Darst. Sa[..]ugeth., pl. 6. Saudi Arabia, Farasan Isls. Not certainly known. 343 169 0 bennettii SPECIES Gazella bennettii (Sykes, 1831). Proc. Zool. Soc. ... http://srs.embl-heidelberg.de:8000/srs5bin/cgi-bin/wgetz?-e+%5B%7Bswissprot_SP_swissnew%7D-acc:O48346%5D ID COX3_GAZGA STANDARD; PRT; 261 AA. AC O48346; O47712; O48347; DT ...: 1.9.3.1). GN MTCO3 OR COIII. OS Gazella gazella (Mountain gazelle), and OS Gazella bennettii (Chinkara). OG Mitochondrion. OC Eukaryota ... http://www.indiabirds.com/HotSpots/FullDetails.asp?spotid=295&page=3 IndiaBirds.com - HotSpots: Cervus axis Sambar -Cervus unicolor Nilgai -Boselaphus tragocamelus Blackbuck -Antilope cervicapra Chinkara (Indian Gazelle) -Gazella bennettii Northern Palm ... http://www.planet-mammiferes.org/MammifPM/NewSpec.html [an error occurred while processing this directive] Gazella bennettii [an error occurred while processing this directive] 8978 Chinkara, Indian Gazelle, Gazelle De L'inde Chinkara, Indian Gazelle, Gazelle De L'inde Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |