|
|
Gazella saudiya - Saudi Gazelle, Gacela SaudiIUCN Status: Extinct in the WildIUCN Species Profile http://www.itis.usda.gov/servlet/SingleRpt/SingleRpt?search_topic=TSN&search_value=625098 ITIS Standard Report Page: Gazella saudiya: Go to Print Version, Gazella saudiya Carruthers and Schwarz, 1935 Taxonomic Serial No.: 625098. Taxonomy and Nomenclature, Kingdom: Animalia, ... http://www.itis.usda.gov/servlet/SingleRpt/SingleRpt?search_topic=TSN&search_value=624969 ITIS Standard Report Page: Gazella: Species, Gazella rufina Thomas, 1894 -- red gazelle, Species, Gazella saudiya Carruthers and Schwarz, 1935 -- Saudi Arabian gazelle, Saudi gazelle, ... http://www.blackwell-synergy.com/links/doi/10.1046/j.1523-1739.2001.0150041123.x/full/ Phylogenetic Reanalysis of the Saudi Gazelle and Its Implications ...: The Saudi gazelle ( Gazella saudiya) was endemic to the Arabian peninsula but is now considered extinct in the wild and is potentially a candidate for captive ... http://animaldiversity.ummz.umich.edu/site/accounts/classification/Gazella_saudiya.html ADW: Gazella saudiya: Classification: Gazella saudiya (Saudi gazelle). Classification. ... Parent taxa. pictures specimens. Genus Gazella (gazelles). Species Gazella saudiya (Saudi gazelle). ... http://animaldiversity.ummz.umich.edu/site/accounts/information/Gazella.html ADW: Gazella: Classification: ...rufina (red gazelle). Species Gazella saudiya (Saudi gazelle). Species Gazella soemmerringii (Sömmerring's gazelle). Species Gazella ... http://www.interaktv.com/mammals/TubuliArt.html Biologybase: Mammals of the World: Tubulidentata through ...: Gazella granti. Gazella leptoceros. Gazella rufifrons. Gazella rufina. Gazella saudiya. Gazella soemmerringii. Gazella spekei. Gazella subgutturosa. Gazella thomsonii. ... http://212.187.155.84/pass_06june/subdirectories_for_search/SpeciesKingdoms/0Families_ACrM_Artiodactyla/Bovidae/Gazella/Gazella_saudiya/Gazella_saudiya.html Gazella saudiya - (Species Link Page): SPECIES LINK PAGE. Gazella saudiya - : Summary Information. Living Organisms / Animalia / Craniata / Mammalia / Artiodactyla / Bovidae / Gazella / Species ... http://212.187.155.84/pass_06june/subdirectories_for_search/SpeciesKingdoms/0Families_ACrM_Artiodactyla/Bovidae/Gazella/Gazella.htm Gazella - (Genus): Link page only); Gazella rufina - Red gazelle (Link page only); Gazella saudiya - (Link page only); Gazella soemmerringii - Soemmerring's ... http://www.earthwitness.com/Animals.htm Earth Witness Community - Extinct Animals Page One: Arabian Gazelle. Gazella arabica. Red Gazelle. Gazella rufina. Saudi Gazelle. Gazella saudiya. Genophantis leahi. Geocapromys columbianus. Geocapromys sp. ... http://perso.club-internet.fr/boudetjo/ZooList/Mammif/Eteint.html Espèces éteintes: Gazella rufifrons rufina, Thomas, 1894. Algeria. Eteint depuis 1894 ou 1940?? Gazella saudiya, Gazelle Dorcas d'Arabie Séoudite, Gazelle Arabe, Saudi Gazelle. ... http://perso.club-internet.fr/boudetjo/ZooList/Mammif/ClasArti.html Classification des Artiodactyles: ...- ... dama Gazella dorcas Gazella gazella Gazella granti Gazella leptoceros Gazella psolea Gazella rufifrons Gazella rufina Gazella saudiya Gazella soemmerringii ... http://www.ibase4web.com/uitgestorven%20dieren.shtml Uitgestorven dieren iBase4web: Equus przewalskii - Mongolian Wild Horse. Gallirallus owstoni - Guam Rail. Gazella saudiya - Saudi Gazelle. Geochelone nigra abingdoni - Abingdon Island Tortoise. ... http://www.ibase4web.com/uitgestorven_in_het_wild.htm Uitgestorven in het wild: Zoogdieren. Ammotragus lervia ornata - Egyptian Barbary Sheep. Gazella saudiya - Saudi Gazelle. Oryx dammah - Sahara Oryx. Canis lupus baileyi - Mexican Grey Wolf. ... http://home.no.net/trohi/mammalia/artiodactyla/bovidae.html bovidae.html: ..., Gazella rufina, ¥¥¥(1894)????Red gazelle(Rufous Gazelle). ", Gazella saudiya, ¥¥???Saudia Arabian gazelle/Tidligere G. dorcas saudiya. ... http://zcog.org/zcog%20frames/library_captivity_files/Bovidae/bovidae.htm Bovidae: ...- ... Gazella rufifrons. Gacela de frente roja V. Gazella saudiya G. dorcas saudiya. Gacela de Arabia Saudà E. Gazella soemmerringii. Gacela de Sommering V. ... http://www.markuskappeler.ch/tex/texs/dorkasgazelle.html Dorkasgazelle: ...- ... haben aber nun gezeigt, dass es sich dabei um andere Arten handelt, nämlich um die Jemen-Gazelle (Gazella bilkis) und die Saudi-Gazelle (Gazella saudiya). ... http://arts.anu.edu.au/grovco/Arabia.htm Fichier HTML: ...above). Photo by Chris Furley, about 1985. Saudi Gazelle (Gazella saudiya) in Al Ain Zoo, 1987. The species may be extinct in the wild. ... http://utne.nvg.org/g/bovidae.html SkrivarstuÃ¥: Fe (Bovidæ): ...gazelle); Gazella rufifrons (red-fronted gazelle); Gazella saudiya (Saudi gazelle); Gazella soemmerringii (Soemmerring's gazelle); Gazella ... http://www.petermaas.nl/extinct/wilduk.htm Recently Extinct Animals - Extinct in the wild: Equus przewalskii, Mongolian Wild Horse, IUCN Species Information. Gazella saudiya, Saudi Gazelle, IUCN Species Information. Macropus ... http://www.savci.upol.cz/teorie/vyhubeni.htm Vyhubenà savci/Extinct mammals: Zebra quagga (Equus quagga). (Gazella arabica). (Gazella bilkis). (Gazella rufina). (Gazella saudiya). Vyhubena ve volne prirode. (Geocapropmys columbianus). ... http://www.savci.upol.cz/sudokop.htm Artiodactyla - SudokopytnÃci: 1846) - gazela rezavoÄ?elá - Red-fronted or Heuglin's Gazelle + Gazella rufina (Thomas, 1894) - gazela Ä?ervená - Red Gazelle + Gazella saudiya (Carruthers & ... http://www.deer.rr.ualberta.ca/library/taxonomy/Artiodactyla.html Artiodactyla: ...dama Gazella dorcas Gazella gazella Gazella granti - Grant's gazelle Gazella leptoceros Gazella rufifrons Gazella rufina Gazella saudiya Gazella soemmerringii ... http://www.ergo-light.com/ERGO/CGI/prot.cgi?prot=RCY12508&user= Protein Page for RCY12508 from Synechocystis sp. PCC6803: Gazella rufifrons, pirnr|NF00202987, 5.48e-12, 251, 65, Cytochrome c oxidase polypeptide III (EC 1.9.3.1), Gazella saudiya, pirnr|NF00202998, ... http://swfsc.nmfs.noaa.gov/prd/PROJECTS/MEL/CG/Steve/gazelle.html Cryptic Species of Mudfish in New Zealand: The Saudi Gazelle (Gazella saudiya), a species once common in western Arabia, is now considered extinct in the wild with only a few purported pure populations ... http://www.ultimateungulate.com/Artiodactyla.html Artiodactyla: ...leptoceros Slender-horned gazelle, Rhim Gazella rufifrons Red-fronted gazelle, Heuglin's gazelle Gazella rufina Red gazelle Gazella saudiya Saudi gazelle ... http://www.specola.unifi.it/evaidc/RedList.idc?class=MAMMALIA&order=&family=&Status=0 EVA - List -: ...- ... MAMMALIA, Arctiodactyla, Bovidae, Gazella rufina, MAMMALIA, Arctiodactyla, Bovidae, Gazella saudiya, MAMMALIA, Arctiodactyla, Bovidae, Hemitragus hylocrius, ... http://www.specola.unifi.it/EVAidc/RedList.idc?class=&order=&family=&status=3 EVA - List -: AVES, Psittaciformes, Psittacidae, Strigops habroptilus, MAMMALIA, Arctiodactyla, Bovidae, Gazella saudiya, MAMMALIA, Carnivora, Mustelidae, Mustela nigripes, ... http://www.unep-wcmc.org/latenews/Iraq_2003/threatened_species.htm Conflict and the Environment in Iraq: M, Oryx leucoryx, Arabian oryx, EN, M, Equus hemionus ssp. hemippus, Syrian wild ass, EX, Extinct. M, Gazella saudiya, Saudi gazelle, EW, Extinct in wild. ... http://www.earthscape.org/r2/scb/scb15_4/har01/har01.html Phylogenetic Reanalysis of the Saudi Gazelle and Its Implications ...: The Saudi gazelle (Gazella saudiya) was endemic to the Arabian peninsula but is now considered extinct in the wild and is potentially a candidate for captive ... http://www.phthiraptera.org/Mammals/Bovidae.html Mammals: Bovidae: Linognathus tibialis (Piaget, 1880). Gazella rufina Thomas, 1894 - Red Gazelle; Gazella saudiya Carruthers and Schwarz, 1935 - Saudi Gazelle; ... http://www.saudiaramcoworld.com/issue/199406/elusive.encounters.htm Saudi Aramco World : Elusive Encounters: Of the three known species of gazelle native to the kingdom, the 'afri, or Saudi gazelle (Gazella saudiya), is now extinct in the wild, the rheem, or sand ... http://pedant.gsf.de/cgi-bin/wwwfly.pl?Set=Synechocystis_PCC6803&Alias=Synechocystis_PCC6803&Page=taxrankspecies Synechocystis_PCC6803: ...morhua galactomyces geotrichum galdieria sulphuraria gallus gallus gazella cuvieri gazella leptoceros gazella rufifrons gazella saudiya gazella subgutturosa ... http://www.medwetcoast.com/article.php3?id_article=104 Vertebrate Fauna Analysis of Wadi Gaza (Amphibians, Reptiles ...: While the Saharo-Arabian desert Hedgehog Paraechinus aethiopicus and Dorcas Gazelle Gazella saudiya show partial overlap in distribution with those from ... http://www.nih.go.jp/yoken/genebank/MNCb/seq5/MNCb-0886.BLA BLASTN 2.0a2MP-WashU [20-Oct-1996] [Build 22:58:53 Oct 20 1996] ...: 1124 9.6e-45 1 RO|U21614||| OLU21614 Onychomys leucogaster isolate LVT... 1129 1.1e-44 1 OM|AF030481||| AF030481 Gazella saudiya cytochrome oxidas... ... http://encyklopedia.pwn.pl/452410_1.html Encyklopedia PWN: Na Półwyspie Arabskim żyjÄ… gazele: dorkas, dżejran i gazela saudyjska (Gazella saudiya), myszoskoczka (Meriones sacramenti), skoczki pustynne (Gerbillus ... http://people.zeelandnet.nl/mderweduwe/uitgestorveninhetwild.html uitgestorven in het wild: Ammotragus lervia ornata - Egyptian Barbary Sheep Gazella saudiya - Saudi Gazelle Oryx dammah - Sahara Oryx Canis lupus (mexican subpopulation) - Grey Wolf ... http://www.soe.ucsc.edu/research/compbio/yeast-protein-predictions/Q027/Q0275/Q0275.t2k.pa.html a2m2html output for file tmp.a2m: ...gi|2731940|gb|AAB93620.1| cytochrome oxidase subunit III [Gazella saudiya]. gi|9653266|ref|NP_062473.1|_3:260 cytochrome c oxidase subunit III [Physeter catodon ... http://www.uwsp.edu/geo/faculty/heywood/geog358/endangr/extinctM/extinctML.htm COMMON NAME: Rufous [Red] Gazelle, Gazella rufina, 1894, Morocco to Algeria, Saudi Gazelle, Gazella saudiya, 1996, Syria, Iraq, Kuwait, Saudi Arabia, Yemen, ... http://content.karger.com/ProdukteDB/produkte.asp?Aktion=ShowFulltext&ProduktNr=224037&Ausgabe=229862&ArtikelNr=75752 Karger Publishers: External Resources Kumamoto AT, Kingswood SC, Rehbolz WER, Houck ML: The chromosomes of Gazella bennetti and Gazella saudiya. Z ... http://srs.sanger.ac.uk/srs5bin/cgi-bin/wgetz?-id+2keC41M_g7t+%5Bswissprot-AccNumber:O47710%5D+-e Entry Page: Description, cytochrome c oxidase polypeptide iii (EC 1.9.3.1). Gene name(s), mtco3 or coiii. Organism source, Gazella saudiya (Saudi gazelle). ... http://srs.embl-heidelberg.de:8000/srs5bin/cgi-bin/wgetz?-e+%5B%7Bswissprot_SP_swissnew%7D-acc:O47710%5D ID COX3_GAZSA STANDARD; PRT; 261 AA. AC O47710; DT 15-JUL-1999 ...: 41, Last annotation update) DE Cytochrome c oxidase polypeptide III (EC 1.9.3.1). GN MTCO3 OR COIII. OS Gazella saudiya (Saudi gazelle). OG Mitochondrion. ... http://home.conceptsfa.nl/~pmaas/rea/wild.htm Peter's Homepage - Uitgestorven Dieren - Uitgestorven in het wild.: Equus przewalskii - Mongolian Wild Horse IUCN Species Information. Gazella saudiya - Saudi Gazelle IUCN Species Information. Macropus ... http://www.mnh.si.edu/botany/bcn/issue/168.html Biological Conservation Newsletter: Rebholz, W. and Harley, E. 1997. Cytochrome b sequences from the endangered Saudi gazelle (Gazella saudiya) suggest hybridization with Chinkara (G. bennetti). ... http://www.micro-genomes.mpg.de/cgi-bin/getblast.cgi?pir030305.orfprot.RB12685-ctaE.blastp getblast.pl beck@molgen-mpg.de: 46 0.001 SWISSPROT:COX3_GAZCU O47708 gazella cuvieri (cuvier's gazelle) (... 46 0.001 SWISSPROT:COX3_GAZSA O47710 gazella saudiya (saudi gazelle). cyt... ... http://www.cannabinoid.com/boards/thd1x54897.shtml Marihemp: Politics: Thread #54897: ...pacificus Wake Island Rail Gallirallus wakensis Arabian Gazelle Gazella arabica Red Gazelle Gazella rufina Saudi Gazelle Gazella saudiya Genophantis leahi ... http://nema.cap.ed.ac.uk/nematodeESTs/Ascaris/Ascaris250-299/Asmc-283xnr.html National Center for Biotechnology Information (NCBI) Welcome to ...: ...- ... Sbjct: 143 TVTWAHHSLMEGNRKETTQALIFTVLLGLYFTALQAMEYYEAPFTIADSVYGATF 197 gb|AAB93620.1| (AF030481) cytochrome oxidase subunit III [Gazella saudiya] Length = 261 ... http://www.esapubs.org/archive/ecol/E084/094/MOMv3.3.txt AF extant Artiodactyla Bovidae Addax nasomaculatus 4.85 70000.3 60 ...: ...- ... Gazella gazella 4.36 23000 115 EA extant Artiodactyla Bovidae Gazella bennettii 4.28 18916.7 133 EA extant Artiodactyla Bovidae Gazella saudiya 4.2 16000 143 ... http://www.astronomy.net/forums/god/messages/23230.shtml?show=top Ecological History Of Earth (partial List) - an Astronomy Net God ...: ...- ... Arctiodactyla Bovidae Gazella leptoceros MAMMALIA Arctiodactyla Bovidae Gazella rufina MAMMALIA Arctiodactyla Bovidae Gazella saudiya MAMMALIA Arctiodactyla ... http://genoma.unsam.edu.ar/projects/tca/blast_dir/nr/tca-05c3.b1.br BLASTX 2.1.3 [Apr-1-2001] Reference: Altschul, Stephen F., Thomas ...: 258 >sp|O47710|COX3_GAZSA CYTOCHROME C OXIDASE POLYPEPTIDE III gb|AAB93620.1| (AF030481) cytochrome oxidase subunit III [Gazella saudiya] Length = 261 Score ... http://genoma.unsam.edu.ar/projects/tca/blast_dir/nr/tca-01l10.b1MT.br BLASTX 2.1.3 [Apr-1-2001] Reference: Altschul, Stephen F., Thomas ...: 257 >sp|O47710|COX3_GAZSA CYTOCHROME C OXIDASE POLYPEPTIDE III gb|AAB93620.1| (AF030481) cytochrome oxidase subunit III [Gazella saudiya] Length = 261 Score ... http://uk.groups.yahoo.com/group/teachersnewslink/message/319 Yahoo! Groups : teachersnewslink Messages : Message 319 of 337: Dromaius ater Kangaroo Island Emu Dromaius baudinianus Arabian Gazelle Gazella arabica Red Gazelle Gazella rufina Saudi Gazelle Gazella saudiya Black-backed ... http://students.kennesaw.edu/~cwc6898/Animals.htm Animal Extinction: EW - Extinct in the Wild-. Saudi Gazelle (Gazella saudiya). This species, once common in western Arabia, is known to exist only in captivity. ... http://www.rickertweb.com/~justin/School/CS360%20Database%20Systems/PC4/Data/TAXON/HOOVES.txt [an error occurred while processing this directive] Gazella saudiya [an error occurred while processing this directive] 8980 Saudi Gazelle, Gacela Saudi Saudi Gazelle, Gacela Saudi Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |