|
Gerbillus campestris - North African GerbilIUCN Status: Lower Risk/Least ConcernIUCN Species Profile http://www.funet.fi/pub/sci/bio/life/warp/mammals-index-h.html All (in this database) Mammals list (Scientific names): ...dorcas fuscifrons; haymani (Gerbillus campestris), see Gerbillus campestris; hazenna (Gazella), see Gazella dorcas bennetti; heathi ... http://www.gerbil-info.com/html/large_north_african_gerbil.htm Large North African Gerbil: Scientific Name: GERBILLUS CAMPESTRIS. External features: G. campestris is yellow-orange coloured, as most gerbillus species. The belly is white. ... http://www.gerbil-info.com/html/other_gerbil_species.htm Other Gerbil Species: There are 87 gerbil species known (see below for links to specific species). So 86 more than the popular and known Mongolian gerbil. ... http://users.bart.nl/~fredveen/othercam.htm othercamp: Scientific Name: GERBILLUS CAMPESTRIS. Common Name: LARGE NORTH AFRICAN DIPODIL. External features: G. campestris is yellow-orange ... http://users.bart.nl/~fredveen/other.htm The Other Gerbil Species: SCIENTIFIC NAME. COMMON NAME. GERBILLUS AMOENUS, CHARMING DIPODIL. GERBILLUS ANDERSONI, ANDERSON'S GERBIL. GERBILLUS CAMPESTRIS, LARGE NORTH AFRICAN DIPODIL. ... http://www.omne-vivum.com/b/3104.htm genus Gerbillus- -: T" "Gerbillus campestris species: Gerbillus campestris. ... http://www.findit.co.uk/pets/others/1218452.htm Pets - Other Pets - Suspected gerbillus campestris sub-species for ...: Email address. Suspected gerbillus campestris sub-species for sale. Advertiser's status: Private. Ad type: For sale. Date: 27 May 2004, ... http://www.findit.co.uk/pets/others.htm Pets - Other Pets For Sale, Wanted, For Hire: For sale, LINCOLN , LINCOLNSHIRE, 3 female chinchillars. For sale, havant , Hampshire, Suspected gerbillus campestris sub-species for sale. ... http://www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=Gerbillus+campestris+%5Bgbrod%5D Codon usage table: Gerbillus campestris [gbrod]: 1 CDS's (181 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU 5.5( 1) UCU 5.5( 1 ... http://www.kazusa.or.jp/codon/G.html Alphabetical list: G: M128 [gbpln]: 2 Gerbera hybrid cultivar [gbpln]: 7 Gerbera hybrid cv. 'Terra Regina' [gbpln]: 15 Gerbillus campestris [gbrod]: 1 Gerbillus nigeriae [gbrod]: 1 ... http://www.zzf.de/zza/031240.html ZZF: ZZA 12/2003 S. 40: Gerbillus campestris liebt Sand und Wärme: ...- ZZA - Zoologischer Zentral Anzeiger, Diese Seite drucken. TierNatur. Interessante Rennmausarten. Gerbillus campestris liebt Sand und Wärme. ... http://www.zzf.de/zza/031048.html ZZF: ZZA 10/2003 S. 48: Die kleine Rennmaus mit den haarigen ...: ...- ... Empfehlenswert für die Heimtierhaltung sind außerdem die nordafrikanische Feldrennmaus (Gerbillus campestris), die Cheesmans Rennmaus (Gerbillus cheesmani ... http://www.interaktv.com/mammals/Rodentia2myo.html Biologybase: Mammals of the World: Rodentia 2 (Myomorpha): Gerbillus bottai. Gerbillus brockmani. Gerbillus burtoni. Gerbillus campestris. Gerbillus cheesmani. Gerbillus cosensis. Gerbillus dalloni. Gerbillus dasyurus. ... http://www.daimi.au.dk/~chili/CSS/Exercises/Project1/gde2.gde { name "MPU28721" type "DNA" longname Mus pahari sequence-ID " ...: CCCTAAGGCATCTGCCCTCGGTGCTTGTTCCTAGAGACGAACTCTGCTCT" } { name "GCU28961" type "DNA" longname Gerbillus campestris sequence-ID "U28961" descrip "Gerbillus ... http://www.gerbils.pwp.blueyonder.co.uk/gerbils/other.htm Gerbil Species Info: Charming Dipodil, Gerbillus amoenus. The Rock Gerbil, Gerbillus campestris. Wagner's Dipodil, Gerbillus dasyurus. Baluchistan Gerbil, Gerbillus nanus. ... http://www.gerbils.pwp.blueyonder.co.uk/gerbils/species.htm Gerbil Species List: Gerbillus campestris, The Rock Gerbil; Large North African Dipodil French: Gerbille des champs; German: Feldrenmaus, Atlantic coast of Sahara to Egypt and ... http://www.americazoo.com/goto/index/mammals/183.htm Large North African gerbil: Large North African gerbil - GERBILLUS CAMPESTRIS. Class: Animals with Milk Glands (Mammalia) Subclass: True Mammals (Eutheria) Order ... http://www.il-st-acad-sci.org/mammals/gerbil01.html GERBILS AND JIRDS: Sudan Dipoldil, Gerbillus bottai. Large North African Dipodil, Gerbillus campestris. Wagner´s Dipodil, Gerbillus dasyurus. Black-Tufted Gerbil, Gerbillus famulus. ... http://www.exotics.nl/foto/thumbnails.php?album=5 Knaagdieren Foto's - Gerbillus Campestris: Home > Gerbils > Gerbillus Campestris. Gerbillus Campestris. TITEL, +, -. BESTANDSNAAM, +, -. DATUM, +, -. campestris001.jpg 11 x bekeken. campestris002.jpg 15 x bekeken. ... http://www.exotics.nl/foto/ Knaagdieren Foto's - Welkom !: Dikstaart Gerbil. 22 foto's, laatste toegevoegd op 17 mei 2004. Gerbillus Campestris. 3 foto's, laatste toegevoegd op 17 feb 2004. Indische Gerbil. ... http://www.gerbiiliyhdistys.fi/harvinaiset/hkaavio.html SGY ry - Systemaattinen kaavio hyppymyyristä: ALAHEIMO: GERBILLINAE SUKU: AMMODILLUS BRACHIONES DESMODILLUS GERBILLURUS GERBILLUS (varsinaiset gerbiilit) LAJI: Gerbillus campestris Gerbillus gerbillus ... http://www.gerbiiliyhdistys.fi/nayttelyt/menestyneita.html SGY ry - Menestyneita gerbiileitä, deguja ja muita hyppymyyriä: Pia Vesala. Menestyneitä muita hyppymyyriä. Manetjes Bellington, perpallidus, om. Pia Vesala; Pullukan Piparkakku, perpallidus tai gerbillus campestris, om. ... http://www.das-tierlexikon.de/inhalt_w.htm Wale oder Waltiere: ...- ... Gerbillurus paeba. - Gerbillurus vallinus. - Gerbillus. - Gerbillus campestris. - Gerbillus dasyurus. - Gerbillus perpallidillus. - Gerbillus latastei. ... http://www.das-tierlexikon.de/wuehlmaeuse.htm Wühlmäuse: ...- ... aus etwa 34 Arten. Die Feld-Rennmaus (Gerbillus campestris) lebt in Sandwüsten von Marokko bis Somalia. Sie erreicht eine Kopf-Rumpf ... http://homepage.ntlworld.com/jean.wright3/articles/pygmy/ Pygmy Species: Mouse and Gerbil: I personally think they may be a subspecies of Gerbillus campestris (rock gerbil), which can be very variable in description depending on where they were caught ... http://www.chez.com/rodent/Gerbillidae/Gerbillidae.html Gerbillidae: ...- ... Gerbillus bottai - Soudan et Kenya. Gerbillus campestris - Large North African Dipodil - Gerbille des champs - Somalie. Gerbillus ... http://www.virtualcentre.org/fr/res/int/atelier_niamey/atelier_niamey02.htm Contribution du Niger: ...- ... Desmodilliscus braueri* Gerbillus campestris*, G. gerbillus*, G. henleyi*, G. nancillus*, G. nanus*, G. nigeriae*, G. pyramidum* et G. tarabuli* Meriones ... http://members.tripod.com/~Nager/dic5.htm Rodent Dictionary: ...- ... Charming dipodil, Gerbillus amoenus, Giza-Zwergrennmaus, ---. Large North African Gerbil, Gerbillus campestris, Feldrennmaus, Gerbille des champs. ... http://www.glenoakzoo.org/Common%20Name.htm Common Name: 276. INDIAN GERBIL. Tatera indica. 101. LARGE NORTH AFRICAN GERBIL. Gerbillus campestris. 157. MIDDAY GERBIL. Meriones meridianus nogaiorum. 158. MIDDAY GERBIL. ... http://www.glenoakzoo.org/scientific_name.htm Scientific Name: HAIRY-FOOTED GERBIL. 100. Gerbillus. NORTHERN PYGMY GERBIL. 101. Gerbillus campestris. LARGE NORTH AFRICAN GERBIL. 102. Gerbillus dasyurus. WAGNER'S GERBIL. 103. ... http://www.ferpharm.dk/foto/Exsotic/ drivhuset: 1-2 cm larger. Updated: 20. april 2004, Scientific name: Gerbillus campestris. Photo by: Søren ThinggÃ¥rd. Location: Roskilde, Origin: Egypt, : Keep and treat: ... http://www.ig-rennmaeuse.de/andererennmausarten.htm rennmausarten im ueberblick: ...- ... mesopotamiae). Nigerian Gerbil (Gerbillus nigeriae). North African Gerbil (Gerbillus campestris). Occidental Gerbil (Gerbillus occiduus). ... http://www.ig-rennmaeuse.de/feldrennmaus.htm feldrennmaus: ...- ... Der Name "Feldrennmaus" ist für diese Art falsch. Feldrennmäuse ist die deutsche Bezeichnung für den Gerbillus campestris, The Rock Gerbil. ... http://www.nws-wiesbaden.de/samm030.html Museum Wiesbaden - Naturwissenschaftliche Sammlung: Sammlungen ...: ...- ... Rennmaus]; Cricetidae: Gerbillus campestris Levaillant [Feld-Rennmaus]; Cricetidae: Gerbillus gerbillus (Olivier) [Rennmaus]; Cricetidae ... http://www.unipv.it/webbio/dbagsh.htm DBA MAMMALIAN GENOME SIZE DATABASE: ...- ... Bolomys obscurus, RODENTIA, 5.97, 34, 34, 1983, Bianchi. Gerbillus campestris, RODENTIA, 7.34, 56, 1982, Gamperl. Gerbillus pyramidum, RODENTIA, 7.93, 40, 1982, Gamperl. ... http://www.unipv.it/webbio/dbagst.htm DBA MAMMALIAN GENOME SIZE DATABASE: ...- ... olivaceus RODENTIA 6.10 0 0 0 Akodon xanthorhinus RODENTIA 6.32 0 0 0 Bolomys obscurus RODENTIA 5.97 34 34 1983 Bianchi Gerbillus campestris RODENTIA 7.34 56 0 ... http://ladywildlife.com/animal/gerbil.html Ladywildlifes Gerbil Page: Common Gerbil Species: Large North African Gerbil, Gerbillus campestris: Long ears, pale color, large eyes, and long tail. Great ... http://www.uh2m.ac.ma/fstm/enseigna/oufara.html Faculté des Sciences et Techniques:Oufara: ...- ... Oufara S. et J. Chatonnet (1987). Adaptations métaboliques de la gerbille, Gerbillus campestris, au climat désertique. Comparaison avec la souris blanche. ... http://www.tierseiten.com/nagetiere/nagetieresystematik.html Systematik der Nagetiere: ...- ... Langschwänziger Hamster) Unterfamilie: Gerbillinae (Rennmäuse) Gattung: Gerbillus (Eigentliche Rennmäuse) Art: Gerbillus campestris (Feld-Rennmaus) Art ... http://www.museumkoenig.uni-bonn.de/for/dfor_huber_acri.htm Arachnida am Museum Koenig (D): 1m 1f, 2 slides. MOROCCO. host: Gerbillus campestris. Afrolistrophorus dipodicola (Traegardh, 1904). 1m 1f, 2 slides. EGYPT & TUNISIA. ... http://www.cbs.dtu.dk/databases/DOGS/abbr_table.txt Sat Jan 13 16:42:48 MET 2001 DOGS abbreviated genome size table ...: ...- ... Galago crass.crassicaudatu 3,922,900,000 Galago senegalensis 4,130,200,000 Gallus gallus 1,200,000,000 Gerbillus campestris 3,621,900,000 Gerbillus pyramidum ... http://www.cbs.dtu.dk/databases/DOGS/abbr_table.common.txt Sat Jan 13 16:42:49 MET 2001 DOGS abbreviated genome size table ...: Galago crass.argentatus 3,202,500,000 Galago crass.crassicaudatu 3,922,900,000 Galago senegalensis 4,130,200,000 Gerbillus campestris 3,621,900,000 Gerbillus ... http://www.mail-archive.com/gerbils@listserv.rice.edu/msg07536.html Re: New Mystery Species: File Format: Unrecognized - View as HTML ... Regards. >Vera. >. >. The mammal curator at the American Museum of Natural History says that. everything is consistent with Gerbillus campestris. Which would mean. ... http://goliath.power-guestbook.de/foren/F_0197/cutecast.pl?forum=29&thread=91 Nagerforum: ...- ... Außerdem gibt es noch die Feld-Rennmaus (Gerbillus campestris), sie ist aber sehr scheu und soll auch noch nach langer Pflege vor dem Halter flüchten, wenn ... http://www.savci.upol.cz/hlod-2.htm Rodentia - Hlodavci: 1910) - pÃskomil Brockmanův - Brockman's Gerbil Gerbillus burtoni F. Cuvier, 1838 - pÃskomil Burtonův - Burton's Gerbil Gerbillus campestris (Loche, 1867 ... http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Retrieve&dopt=Citation&list_uids=97176443 Substitution rate variation in closely related rodent species.: ...phosphorybosyltransferase (APRT) gene from Mus spicilegus, Mus pahari, Mastomys hildebrandtii, Stochomys longicaudatus and Gerbillus campestris and compared ... http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&list_uids=2842012&dopt=Citation [Metabolic adaptations of the gerbil, Gerbillus campestris, to a ...: ...[Metabolic adaptations of the gerbil, Gerbillus campestris, to a desert climate. Comparison with white mice] [Article in French] Oufara ... http://www.phthiraptera.org/Mammals/Muridae.html Mammals: Muridae: Gerbillus campestris (Loche, 1867) - North African Gerbil Polyplax kaiseri Johnson, 1960. Gerbillus cheesmani Thomas, 1919 - Cheesman´s Gerbil ... http://pedant.gsf.de/cgi-bin/wwwfly.pl?Set=Mycoplasma_genitalium_G37&Alias=Mycoplasma_genitalium_G37&Page=taxrankspecies Mycoplasma_genitalium_G37: ...pennivorans flavobacterium johnsoniae francisella tularensis galdieria sulphuraria gallus gallus geodia cydonium gerbillus campestris guillardia theta ... http://pedant.gsf.de/cgi-bin/wwwfly.pl?Set=Mycoplasma_gallisepticum_R&Alias=Mycoplasma_gallisepticum_R&Page=taxrankspecies Mycoplasma_gallisepticum_R: ...fowlpox virus francisella tularensis fusobacterium nucleatum gadus morhua gallus gallus geobacter sulfurreducens gerbillus campestris giardia intestinalis ... http://www.worldwildlife.org/wildworld/profiles/terrestrial/pa/pa1321_full.html Terrestrial Ecoregions -- North Saharan steppe and woodlands ...: Most of these species are small mammals and include four-toed jerboa (Allactaga tetradactyla, EN), North African gerbil (Gerbillus campestris), James's gerbil ... http://www.worldwildlife.org/wildworld/profiles/terrestrial/pa/pa1331_full.html Terrestrial Ecoregions -- Tibesti-Jebel Uweinat montane xeric ...: ...including hyrax (Procavia capensis), brown hare (Lepus capensis), spiny mouse (Acomys spp.), large North African gerbil (Gerbillus campestris), Nigerian gerbil ... http://eo.wikipedia.org/wiki/Ron%C4%9Duloj RonÄ?uloj - Vikipedio: GERBILO - Gerbillus specio : gerbilo sahara - Gerbillus gerbillus - pÃskomil saharský specio : gerbilo kampa - Gerbillus campestris - pÃskomil polnà genro ... http://www.myerscough.ac.uk/animal/petshop/gerbil.asp Myerscough College Pet Shop - Your Pet Gerbil: Species - Gerbil. Latin Name - Gerbillus Campestris. Origin - Northern Africa. Pet Housing - These rodents are usually housed in glass ... http://www.micro-genomes.mpg.de/cgi-bin/getblast.cgi?pir030305.orfprot.RB5847-apt.blastp getblast.pl beck@molgen-mpg.de: 146 2e-34 SWISSPROT:APT_GERCA Q64414 gerbillus campestris (gerbil). adenin... 145 2e-34 SWISSPROT:APT_STOLO P47958 stochomys longicaudatus. adenine phos... ... http://www.micro-genomes.mpg.de/cgi-bin/getblast.cgi?pir030305.orfprot.RB328-pyrE.blastp getblast.pl beck@molgen-mpg.de: 32 6.0 SWISSPROT:APT_VIBCH Q9kt52 vibrio cholerae. adenine phosphoribos... 32 6.2 SWISSPROT:APT_GERCA Q64414 gerbillus campestris (gerbil). adenin... ... http://sege.ntu.edu.sg/cgi-bin/extract_info.pl?dbase=gbrod&field=protein&pop=179&type=1 Your Search Results: R}AQSTMQKSLKDSKKGKPCSKLGKKCIYQQLVEGRKLR{R}LEAISNS IKASFRVAKLKAELYRDQKLTHNRAH > 44424_GCU28961 Gerbillus campestris adenine phosphoribosyltransferase (APRT) gene ... http://www.chm.ma/biodiversite_nationale/faune.htm CHM Maroc: ...- ... Gerbillidae, Gerbillus Dipodillus Pachyuromys Meriones Psammomys, Gerbillus campestris Gerbillus pyramidum Gerbillus hesperinus Gerbillus hoogstrali Gerbillus ... http://www.chm.ma/gestion_et_conversation/zones_humides.htm CHM Maroc: ...- ... des zones littorales du nord du Maroc (Rana ridibunda, Pleurodeles waltl, Pelobates varaldii, Natrix maura, Mus musculus, Gerbillus campestris, Lepus capensis ... http://dsf.uqac.uquebec.ca/dept/cours/1bio412/mammiferes/m060desc.html Description mammifère 060: ...- Rongeurs Gerbillus campestris Gerbille des champs Corps 12/Queue 12 cm. http://www.rodent.be/rodentnederlands/Taxonomie/muridae.htm Muridae: Gerbillus bottai. Gerbillus burtoni. Gerbillus brockmani. Gerbillus campestris. Gerbillus cheesmani. Gerbillus cosensi. Gerbillus dalloni. Gerbillus dasyurus. ... http://www.vetweb.cz/projekt/clanek.asp?pid=2&cid=716 Vetweb.cz - veterinářstvÃ: Meriones persicus, Meriones shawi, Meriones libycus, Meriones meridianus, Gerbillus gerbillus, Gerbillus campestris, Gerbillus burtoni, atd. ... http://gerbil.info/species.htm SPECIES AND SUB SPECIES OF GERBILLINAE: Gerbillus brockmani (Brokman's gerbil), Somalia. Gerbillus campestris (Large north African dipodil), Atlantic coast of the Sahara to Egypt and Somalia. ... http://ajpregu.physiology.org/cgi/content/abstract/253/1/R39 AJP - Regulatory, Integrative and Comparative Physiology ...: To explain tolerance of heat and cold in gerbils (Gerbillus campestris) in their natural environment, a comparative study was made of thermoregulatory ... http://www.ifrance.com/nblanluet/infogen/origine.htm Origine de la gerbille: ...- ... de l'Agag Gerbillus agag gerbille d'Egypte Gerbillus gerbillus gerbille charmante Gerbillus amoenus gerbille des rochers Gerbillus campestris grande gerbille d ... http://www.ifrance.com/Go-South/lists/mammiferes.htm Mammals of Morocco - Mammifères du Maroc: ...- ... Xerus erythropus - Ecureuil terrestre du Sénégal. GERBILLIDAE. Gerbillus campestris - Gerbille champêtre. Gerbillus nanus - Gerbille naine. ... http://bioinfo.hku.hk/db/cutg/gbrod.spsum Acomys cahirinus: 2 1 12 8 4 1 4 2 7 11 3 1 6 3 12 2 3 13 2 5 16 2 ...: 2 3 3 2 4 10 4 2 3 1 7 1 4 9 2 1 9 6 5 3 9 3 5 9 10 3 9 12 12 6 9 2 12 18 7 17 13 4 4 3 3 5 2 6 14 8 10 2 4 9 6 9 6 7 15 6 7 3 0 0 1 Gerbillus campestris: 1 2 ... http://perso.club-internet.fr/boudetjo/ZooList/Mammif/ClasRode.html Classification des Rodentiens: Gerbillus aquilus Gerbillus bilensis Gerbillus bonhotei Gerbillus bottai Gerbillus brockmani Gerbillus burtoni Gerbillus campestris Gerbillus cheesmani ... http://scilib.univ.kiev.ua/article.php?20694070 Сервер періодичних видань::Каталог ...: ...were the domestic cat (Felis catus), the jackal (Canis aureus), the jerboa (Jaculus orientalis), the merion (Meriones sp.) and the gerbil (Gerbillus campestris ... http://srs.embl-heidelberg.de:8000/srs5bin/cgi-bin/wgetz?-e+%5B%7Bswissprot_SP_swissnew%7D-acc:Q64414%5D ID APT_GERCA STANDARD; PRT; 180 AA. AC Q64414; DT 01-NOV-1997 (Rel ...: 41, Last annotation update) DE Adenine phosphoribosyltransferase (EC 2.4.2.7) (APRT). GN APRT. OS Gerbillus campestris (Gerbil). ... http://www.gerbilsuk.pwp.blueyonder.co.uk/dipodil.htm Dipodil: He also noted it's past associations with Gerbillus Dasyurus (Wagners Gerbil) and Gerbillus Campestris (Rock Gerbil) and advised that future comparisons should ... http://zwierzak00.blog.onet.pl/ zwierzÄ™ta - OnetBlog: GERBILLUS ANDERSONI - MYSZOSKOCZKA. ANDERSON'A GERBILLUS CAMPESTRIS - DUÅ»A MYSZOSKOCZKA PÓÅ?NOCNOAFRYKAŃSKA. GERBILLUS CHEESMANI - MYSZOSKOCZKA. ... http://genome.jgi-psf.org/cgi-bin/dispGeneModel.v4?db=chlre2&tid=157788 Protein Pages: Chlamydomonas reinhardtii (Chlamy): ...genome.jgi-psf.org/cgi-bin/ dispGeneModel.v4?db=chlre2&tid=157788 - 23k - Cached - Similar pages Protein Pages: Phanerochaete chrysosporium (White Rot fungus)genome.jgi-psf.org/cgi-bin/ dispGeneModel.v4?db=whiterot1&id=72907 - 27k - Cached - Similar pages ordo : RONÄœULOJ - Rodentia - hlodavci ... specio : gerbilo sahara - Gerbillus gerbillus - pÃskomil saharskÅ. specio : gerbilo kampa - Gerbillus campestris - pÃskomil polnÃ. genro : tatero - Tatera. ... http://genome.jgi-psf.org/cgi-bin/dispGeneModel.v4?db=whiterot1&id=72907 Protein Pages: Phanerochaete chrysosporium (White Rot fungus): ...genome.jgi-psf.org/cgi-bin/ dispGeneModel.v4?db=whiterot1&id=72907 - 27k - Cached - Similar pages ordo : RONÄœULOJ - Rodentia - hlodavci ... specio : gerbilo sahara - Gerbillus gerbillus - pÃskomil saharskÅ. specio : gerbilo kampa - Gerbillus campestris - pÃskomil polnÃ. genro : tatero - Tatera. ... http://www.mujweb.cz/Veda/traxler/rongul.htm ordo : RONÄœULOJ - Rodentia - hlodavci: ...specio : gerbilo sahara - Gerbillus gerbillus - pÃskomil saharskÅ. specio : gerbilo kampa - Gerbillus campestris - pÃskomil polnÃ. genro : tatero - Tatera. ... http://www.zouhair.8m.com/custom4.html Custom4: ...- ... Commun. Gerbille champêtre : Gerbillus campestris , جـــرذ الØÂـــقول Toute la Tunisie. ... http://www.esapubs.org/archive/ecol/E084/094/MOMv3.3.txt AF extant Artiodactyla Bovidae Addax nasomaculatus 4.85 70000.3 60 ...: ...- ... Muridae Gerbillus dasyurus 1.37 23.5 64 AF extant Rodentia Muridae Gerbillus amoenus 1.12 13.2 128 AF extant Rodentia Muridae Gerbillus campestris 1.45 28.4 ... http://www.nmnh.si.edu/msw/litcit.html Mammal Species of the World Literature Citations: Benazzou, T., and F. Zyadi. 1990. Presence d'une variabilite biometrique chez Gerbillus campestris au Maroc (rongeurs, gerbillides). Mammalia, 54:271-279. ... http://www3.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&list_uids=90247599&dopt=Abstract Increase in cytochrome oxidase capacity of BAT and other tissues ...: ...of different tissues and their possible role in nonshivering thermogenesis (NST) in a desert rodent, the gerbil (Gerbillus campestris), measurements of ... http://www.centrcn.umontreal.ca/~bourdeav/Ribonomics/RIBO/DB_RIBO/HTML/AMP_right1/AMP_right1.rod.sol.filN.REP.CS.html RNA Secondary Structures: 2186|MIS: 2|WOB: 4| ### * intron 1799..2240 |GUAG|G|UUUG|GGGGUUCUC|UGUG|GGGAGAGGCUG|CUGG| --- GCU28961 Gerbillus campestris adenine phosphoribosyltransferase ... http://spock.jouy.inra.fr/NCBI/apt.html BLASTP 2.0.11 [Jan-20-2000] Reference: 179 sp|Q64414|APT_GERCA ADENINE PHOSPHORIBOSYLTRANSFERASE (APRT) >gi|899457 (U28961) adenine phosphoribosyltransferase [Gerbillus campestris] Length = 180 ... http://nar.oupjournals.org/cgi/content/full/27/22/4457 Nucl. Acids. Res. -- Bourdeau et al. 27 (22): 4457: SLU28723; position 1060-1113), Rattus norvegicus (accession no. RATAPRT; position 1104-1138) and Gerbillus campestris (accession no. ... http://genoma.unsam.edu.ar/projects/tca/blast_dir/nr/tca-02e23.b1.br BLASTX 2.1.3 [Apr-1-2001] Reference: Altschul, Stephen F., Thomas ...: 165 >sp|Q64414|APT_GERCA ADENINE PHOSPHORIBOSYLTRANSFERASE (APRT) gb|AAA69924.1| (U28961) adenine phosphoribosyltransferase [Gerbillus campestris] Length = 180 ... http://www.bionet.nsc.ru/chromosomes/rodentia/references.htm Elobius talpinus Pallas: Gamperl R., Vistorin G., 1980. Comparative study of G and C banded chromosome of Gerbillus campestris and Meriones unguiculatus (Rodentia, Gerbillinae). ... http://industry.ebi.ac.uk/~alan/BioWidget/Taxonomy/tax4.data 1 root 1 2759 Eukaryotae 1 42452 unclassified eukaryotes 2759 ...: ...obesus 48138 41262 Tatera 10045 41263 Tatera kempi 41262 41264 Tatera kempi gambiana 41263 10186 Gerbillus 10045 41199 Gerbillus campestris 10186 39472 ... http://ftp.funet.fi/pub/sci/bio/life/warp/mammals-index-g.html All (in this database) Mammals list (Scientific names): ...aegyptiaca; georgianus (Taphozous); Geosciurus (Sciuridae), see Xerus; gerbii (Gerbillus), see Gerbillus campestris; gerbii (Pitymys ... http://www.katrins-und-thomas-tiere.de/html/blasse_rennmaus.html Blasse Rennmaus: ...- ... besteht aus etwa 34 Arten. Die Feld-Rennmaus (Gerbillus campestris) lebt in Sandwüsten von Marokko bis Somalia. Sie erreicht eine Kopf ... http://srs.csc.fi/srs7bin/cgi-bin/wgetz?-id+7BJS21MMxGK+%5Bswissprot-AccNumber:Q64414%5D+-e Entry Page: Description, adenine phosphoribosyltransferase (EC 2.4.2.7) (aprt). Gene name(s), aprt. Organism source, Gerbillus campestris (Gerbil). ... http://www.marsanoost.nl/gerbils/Soorten%20gerbils.htm Soorten gerbils: De Persische Gerbil (Meriones persicus). De Sundevall Gerbil (Meriones crassus perpallidus). Heeft nog geen nederlandse naam. (De Gerbillus Campestris). ... http://beni-belaid.ifrance.com/beni-belaid/zone-humide.htm [an error occurred while processing this directive] Gerbillus campestris [an error occurred while processing this directive] 9112 North African Gerbil North African Gerbil Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |