|
|
Hylobates klossii - Dwarf Gibbon, Kloss's Gibbon, Mentawai Gibbon, Siamang De Kloss, Siamang EnanoIUCN Status: VulnerableIUCN Species Profile http://www.animalinfo.org/groupind.htm Animal Info - Index by Groups of Animals: Crested) Gibbon (Nomascus (Hylobates) concolor) (*P), Hoolock Gibbon (Bunopithecus (Hylobates) hoolock) (*P), Kloss' Gibbon (Hylobates klossii) (*P), Pileated ... http://members.tripod.com/uakari/hylobates_klossii.html Kloss' Gibbon (Hylobates klossii): Kloss’ Gibbon (Hylobates klossii). MORPHOLOGY: This species has relatively long forearms which assist it in suspensory behavior. ... http://members.tripod.com/cacajao/hylobates_links.html Hylobates Links: Janmanch.org: Hylobates hoolock (Hoolock Gibbon) Damisela: Hylobates hoolock (Hoolock Gibbon) (in Spanish) Animal Info: Hylobates klossii (Kloss's Gibbon ... http://www.tiho-hannover.de/gibbons/main/sound/02klos.html Sound Gallery: Hylobates klossii: Hylobates klossii. Short phrases of simple hoots, more complex hoots ("ow-oo") and short trills in males. ... Hylobates klossii sound examples: ... http://www.tiho-hannover.de/gibbons/main/photo/02klos.html Photo Gallery: Hylobates klossii: Kloss's gibbon, Mentawai gibbon, beeloh Hylobates klossii. ... http://www.itis.usda.gov/servlet/SingleRpt/SingleRpt?search_topic=TSN&search_value=573073 ITIS Standard Report Page: Hylobates klossii: Go to Print Version, Hylobates klossii (Miller, 1903) Taxonomic Serial No.: 573073. ... Species, Hylobates klossii (Miller, 1903) -- Kloss' gibbon, Kloss's gibbon, ... http://www.itis.usda.gov/servlet/SingleRpt/SingleRpt?search_topic=TSN&search_value=572836 ITIS Standard Report Page: Hylobates: Species, Hylobates hoolock (Harlan, 1834) -- hoolock gibbon, Species, Hylobates klossii (Miller, 1903) -- Kloss' gibbon, Kloss's gibbon, ... http://www.damisela.com/zoo/mam/primates/hylobatidae/klossii/ Gibón de Kloss: ...- Gibón de Kloss. Hylobates klossii. ... http://www.damisela.com/zoo/mam/primates/hylobatidae/klossii/taxa.htm Hylobates klossii: ...- Gibón de Kloss. Hylobates klossii. TaxonomÃa. El Gibón de Kloss ( Hylobates klossii ) fue presentado a la ciencia por Miller en 1903. ... http://home.mindspring.com/~djwhittaker/id1.html Whittaker CV: Dissertation Title: Evolutionary genetics of Kloss’s gibbons (Hylobates klossii): Systematics, phylogeography, and conservation. ... http://home.mindspring.com/~djwhittaker/id2.html Research: The critically endangered Kloss’s gibbon (Hylobates klossii) is found only on Indonesia’s Mentawai Islands, a small chain of four islands located off the ... http://www.primatis.de/primaten/fakten.asp?ID=2221004 primatis.de - Ordnung und Steckbriefe der lebenden Primatenarten: ...- Affen, unsere tierischen Verwandten. primatis.de - das Primateninformationssystem. ... http://www.markuskappeler.ch/gib/gibs/references.html Javan Silvery Gibbon (Hylobates moloch): ...chant» d'Hylobates concolor leucogenys: comparison avec les emissions sonores homologues d'Hylobates concolor gabriellae et d'Hylobates klossii (iles Mentawai ... http://www.markuskappeler.ch/gib/gibs/akrobaten.html Javanischer Silbergibbon (Hylobates moloch): ...- ... 6. Mentawai-Gibbon oder Biloh (Hylobates klossii) 7. Kappengibbon (Hylobates pileatus) 8. Weisshandgibbon oder Lar (Hylobates lar) 9. Schwarzhandgibbon oder ... http://www.tamansafari.com/news/news.php?cat=2&id=121 TSI - Education - News: Kloss Gibbon ( Hylobates klossii ). The Kloss gibbon is a primate that comes from Mentawai Island. They live in primary and secondary ... http://www.tamansafari.com/news/archive.php?cat=2 TSI - Education - News: ...tree at animals location. •, Kloss Gibbon ( Hylobates klossii ) In Ex-situ conservation only two animals can be found. One is at ... http://encyclopedia.thefreedictionary.com/Pongid Pongid - encyclopedia article about Pongid. Free access, no ...: Superfamily: Catarrhini Family: Hylobatidae Genus: Hylobates Species Hylobates agilis Hylobates concolor Hylobates hoolock Hylobates klossii Hylobates lar ... http://sayer.lab.nig.ac.jp/~silver/our_data/mtDNA/16SrRNA.html 16SrRNA gene: ...by Silver Project) 2 gorilla (AB050154 determined by Silver Project) 3 bonobo (AB050151 determined by Silver Project)> 4 Hylobates klossii (AB050182 determined ... http://www.funet.fi/pub/sci/bio/life/mammalia/primates/hylobatidae/hylobates/ Hylobates: Am. Philos. Soc. 4: 52, TL: Assam, Garo Hills Range: Mentawi Is. Hylobates klossii (Miller, 1903) klossii (Miller, 1903); Smithson. Misc. Coll. ... http://www.gibboncenter.org/hylobates.htm Hylobates: ...photo by Lion Country Safari H.klossiibyLion.JPG (16823 bytes) H. klossii female. Hylobates klossii (Kloss, 1929). Kloss' gibbon. ... http://www.free-definition.com/Gibbon.html Gibbon Definition Meaning Information Explanation: Species. Hylobates agilis Hylobates concolor Hylobates hoolock Hylobates klossii Hylobates lar Hylobates moloch Hylobates muelleri Hylobates pileatus Hylobates ... http://www.primatestore.com/taxonomyscientific.htm Primate Taxonomy Scientific -> Primate Common Names: ...concolor gabriellae - Crested gibbon Hylobates concolor leucogenys - White-cheeked gibbon Hylobates hoolock - Hoolock gibbon Hylobates klossii - Kloss's gibbon ... http://www.origins.tv/darwin/zoo/bigones.htm Zoology -- Gibbons and Great Apes: Hm funereus -- Northern Gray Gibbon -- [ *wpin ] Hylobates klossii -- Kloss' Gibbon -- [ *grc | wisc ] Hylobates moloch -- Silvery, Javan or Moloch Gibbon ... http://www.discovery.de/de/pub/specials/affentheater/gibbons/steckbrief.htm Gibbon-Steckbrief: ...- ... Zur Gattung Hylobates oder der Lar-Gruppe gehören der Schwarzhandgibbon (Hylobates agilis Ungko), der Kloss-Gibbon (Hylobates klossii), der Weisshandgibbon ... http://www.animalomnibus.com/primates.htm Primates - Order Primates: Hylobates hoolock; Kloss Gibbon, Dwarf Sianang, Beeloh - Hylobates klossii; Muller's or Bornean Gibbon - Hylobates muelleri; Pileated ... http://www.primates.com/classification/ Living Primates: Crested gibbon; (Hylobates hoolock) Hoolock gibbon; (Hylobates klossii) Kloss's gibbon; (Hylobates lar) Common gibbon; (Hylobates moloch ... http://nl.wikipedia.org/wiki/Primates_(taxonomie) Primates (taxonomie) - Wikipedia NL: Hylobates gabriellae; Soort: Hylobates hoolock; Soort: Hylobates klossii; Soort: Hylobates lar (gewone gibbon); Soort: Hylobates leucogenys: ... http://home.globalcrossing.net/~brendel/primate.html PRIMATES (prosimians, monkeys, apes and humans): Hylobates concolor (crested gibbon). Hylobates hoolock (Hoolock gibbon). Hylobates klossii (Kloss's gibbon). Hylobates lar (common gibbon). ... http://www.orangutans.com.au/how_to_help.htm How to help: ENDANGERED Nasalis concolor (pig-tailed langur) ENDANGERED Hylobates agilis (dark-handed gibbon, agile gibbon) ENDANGERED Hylobates klossii (Kloss's gibbon ... http://users.bart.nl/~edcolijn/redlistm.html Animal Redlist: Hylobates agilis, Lower risk: near threatened. Hylobates klossii, Vulnerable. Hylobates lar, Lower risk: near threatened. Hylobates moloch, Critically endangered. ... http://users.bart.nl/~edcolijn/primates.html Macaca fascicularis: Status Indonesia : Protected. Hylobates klossii. Author..... Miller, 1903 (Symphalangus klossi). Common Name..... Kloss's gibbon, Dwarf siamang. ... http://www.primate.wisc.edu/pin/amnattax.html TAXONOMIC CLASSIFICATION OF THE PRIMATES: Trachypithecus vetulus Hylobatidae Hylobates Hylobates agilis Hylobates concolor Hylobates gabriellae Hylobates hoolock Hylobates klossii Hylobates lar ... http://www.primate.wisc.edu/pin/idp/wdp/entry/2075 Whittaker, Danielle June: Position: Ph.D. student Areas of interest: Social structure, phylogeography, genetics, conservation Species of interest: Hylobates klossii, Hylobates moloch ... http://www.lateralpuzzles.com/discus/messages/2928/11258.html?1081034799 Lateral Puzzles: Agile Gibbon, Hylobates agilis * Black Gibbon, Hylobates concolor * Hoolock Gibbon, Hylobates hoolock * Kloss' Gibbon, Hylobates klossii * White-handed Gibbon ... http://www.nature-conservation.or.id/redlistm.html Animal Redlist: Hylobates agilis unko, Lower risk: near threatened. Hylobates klossii, Vulnerable. Hylobates lar vestitus, Lower risk: near threatened. ... http://www.nature-conservation.or.id/primates/primates_IUCN.html IUCN RED LIST INDONESIAN PRIMATES: ...threatened. Hylobates agilis albibarbis, Lower risk: near threatened. Hylobates klossii, Vulnerable. Hylobates lar, Lower risk: near threatened. ... http://www.netbiologen.dk/zoologi/primater.htm Familie Cheirogaleidae: Hylobates agilis Agile gibbon Hylobates concolor Crested gibbon Hylobates hoolock Hoolock gibbon Hylobates klossii Kloss's gibbon Hylobates lar Almindelig ... http://perso.club-internet.fr/boudetjo/ZooList/Mammif/ClasPrim.html Classification des Primates: HYLOBATIDAE, Hylobates, Hylobates agilis Hylobates concolor Hylobates gabriellae Hylobates hoolock Hylobates klossii Hylobates lar Hylobates leucogenys Hylobates ... http://staff.washington.edu/timk/primate/photos/Hylobatidae.html Primate Gallery - Hylobatidae: Hylobates klossii (Miller, 1903) Distribution: Mentawai Islands (Indonesia) Status: CITES - Appendix I; US ESA - Endangered; IUCN - Endangered Photo: NA. ... http://staff.washington.edu/timk/cyto/karyotypes/Hylobatidae/ Hylobatidae - Gibbons and Siamang: Hylobates klossii (Miller, 1903) Distribution: Mentawai Islands (Indonesia) Status: CITES - Appendix I; US ESA - Endangered; IUCN - Endangered File: ?; Photo ... http://www.primata.or.id/gibbons.html PUSAT PRIMATA SCHMUTZER: Status Indonesia..... Protected. description. Hylobates klossii. Author..... Miller, 1903 (Symphalangus klossi). Common Name..... ... http://animaldiversity.ummz.umich.edu/site/accounts/classification/path/Hylobates.html.html ADW: Hylobates: Classification: ...cheeked gibbon). information. Species Hylobates hoolock (hoolock gibbon). Species Hylobates klossii (Kloss's gibbon). information pictures. ... http://animaldiversity.ummz.umich.edu/site/accounts/classification/Hylobatidae.html ADW: Hylobatidae: Classification: ...hoolock gibbon). Species Hylobates klossii (Kloss's gibbon). information pictures. Species Hylobates lar (white-handed gibbon). Species ... http://www.primate.or.kr/mpl/poster/42.files/slide0001.htm Molecular phylogeny of Hylobates based on Alu elements of the Y ...: EIF1AY gene, Hum: Homo Sapiens; Ptr: Pan troglodytes; Ggo: Gorilla gotilla; Ppy: Pongo pygmaeus; Hag: Hylobates agilis; Hkl: Hylobates klossii; Hpi: Hylobates ... http://www.ncbi.nlm.nih.gov/dbGSS/dbGSS_summary.html dbGSS Summary: ...ciceris 3 Hylobates klossii 3 Lepisosteus osseus 3 Ovis aries (sheep) 3 Picea mariana 3 Picea rubens 3 Trichoderma hamatum 3 Actinidia deliciosa 2 Adoxophyes ... http://www.ncbi.nlm.nih.gov/genome/cloneserver/nomenclature.shtml Clone Registry: Standardized Clone Names: Gallus gallus (chicken) Library Abbreviations. [an error occurred while processing this directive]. Hylobates klossii (kloss's gibbon) Library Abbreviations. ... http://www.limsi.fr/Individu/chrd/publiliste.html.html Publications et Travaux: ...- ... grand chant" d' Hylobates concolor Leucogenys comparaison avec les émissions sonores d' Hylobates concolor Gabriellae et d` Hylobates Klossii, (Iles Mentawei ... http://www.zoo.cam.ac.uk/zoostaff/cbg/twhitten.html Conservation Biology Group - Tony Whitten: Edinburgh University Press, Edinburgh; Whitten, A. 1984. Ecological and behavioural comparisons between Hylobates klossii and some other gibbon species. ... http://www.wanprc.org/psic/taxonomy.asp PSIC-Taxonomy: Hylobates concolor, Crested gibbon. Hylobates hoolock, Hoolock gibbon. Hylobates klossii, Kloss's gibbon. Hylobates lar, White-handed/Common gibbon. ... http://www.bio.davidson.edu/people/vecase/Behavior/Spring2004/eppolito/references.html Gibbon References: Tilson, RL (1981). "Family Formation Strategies of Kloss Gibbons Hylobates klossii." Folia Primatologica 35(4): 259-287. Whitten, AJ (1982). ... http://www.indomedia.com/intisari/2000/juni/siamang6.htm Siamang: Di dunia binatang, siamang kerdil (Hylobates klossii) rupanya diciptakan sebagai penyanyi unggul. Tak ada seekor siamang kerdil pun yang tak bisa bernyanyi. ... http://www.wildlife.gov.my/jadual1.html JADUAL SATU: 178. Hoolock Gibbon. Hylobates hoolock. 179. Dwarf Gibbon. Hylobates klossii. 180. Grey Gibbon. Hylobates moloch. 181. Muller's Gibbon. Hylobates muelleri. 182. ... http://filin.km.ru/mammels/gibbon.htm гиббоновые: темные тона. ГИББОÐ? КЛОССÐ? (Hylobates klossii) Обитает на оÑ?трове Ментавай. Покрыт ... http://www.birdlist.org/sas/Indonesia/id_mammals.htm ID mammals: Hylobates, agilis, Agile (Black-handed) Gibbon, P. Hylobates, klossii, Kloss Gibbon, Dwarf Sianang, Beeloh, P. Hylobates, lar, White-handed Gibbon, P. ... http://www.seaza.org/Conference/7th_conference/scientific_papers/gibbon_taxonomy_to_be_utilized_b.htm Gibbon Taxonomy to be Utilized by Breeding Facilities: Tenaza, RR (1975): Territory and monogamy among Kloss' gibbons (Hylobates klossii) in Siberut Island, Indonesia. Folia Primatologica 24:60-80. ... http://sea.unep-wcmc.org/isdb/CITES/Taxonomy/country_list.cfm?country=ID&col=99&source=animals&displaylanguage=eng Country Summary Result: Family : HYLOBATIDAE, Hylobates agilis F. Cuvier, 1821 Hylobates klossii (Miller, 1903) Hylobates lar (Linnaeus, 1771) Hylobates moloch (Audebert, 1798) ... http://www.nycep.org/pages/students/students_phd_current.php Current NYCEP PhD Students: CUNY, Danielle Whittaker, Evolutionary genetics of Kloss's gibbons (Hylobates klossii): Systematics, phylogeography, and conservation, ... http://www.biologia.uniba.it/primates/Living%20primates.html All rights reserved. Patent pending.: Hylobates gabriellae. Hylobates hoolock Hoolock Gibbon. Hylobates klossii Kloss' Gibbon or Bilou. Hylobates lar Lar Gibbon. Hylobates leucogenys. Hylobates moloch. ... http://www.hawaii.edu/LAS/species_specific/PRIMATES/9010/appB.html Appendix B: Hylobates concolor leucogenys, white-cheeked gibbon. Hylobates hoolock, hoolock gibbon. Hylobates klossii, Kloss's gibbon. Hylobates lar, lar. ... http://www.worldwildlife.org/wildworld/profiles/terrestrial/im/im0127_full.html Terrestrial Ecoregions -- Mentawai Islands rain forests (IM0127): Four endemic primates are found on the Mentawai Islands: the Mentawai gibbon (Hylobates klossii), Mentawai macaque (Macaca pagensis), Mentawai leaf-monkey ... http://www.anth.ucsb.edu/dbman/db.cgi?db=schedule2003&uid=default&view_records=1&ID=*&nh=7 AAPA 73rd Annual Meeting Abstracts: Search Results.: The Kloss's gibbon (Hylobates klossii), endemic to the Mentawai Islands of Indonesia, is endangered due to commercial logging, hunting, and capture for the pet ... http://www.angelfire.com/apes/izes/zoological%20who's%20who.htm A ZOOLOGICAL: In his time, perhaps the leading expert on the systematics of Southeast Asian birds and mammals. Zoological nomenclature: Kloss’s Gibbon, Hylobates klossii. ... http://www.mentawaionline.com/modules.php?name=News&file=article&sid=10 Mentawai Online - Pulau Siberut Miliki Tipe Ekosistem Hutan ...: Siberut merupakan habitat empat jenis primata endemik yaitu Bilou (Hylobates klossii), Joja (Presbytis potenziani), Simakobu (Simias concolor) dan Bokkoi ... http://mofrinet.cbn.net.id/INFORMASI/TN%20INDO-ENGLISH/tn_siberut.htm Taman Nasional Siberut: ...daerah lainnya di dunia (endemik) yaitu bokkoi (Macaca pagensis), lutung mentawai/joja (Presbytis potenziani siberu), bilou (Hylobates klossii), dan simakobu ... http://tzf.org.tw/gibbon/klos.htm å°?長臂猿: ...ä¸æ–‡å??稱：å°?長臂猿. 英文å??稱：Kloss’s gibbon. å¸å??：Hylobates klossii. 外表特徵：公æ¯?皆為全身漆黑，喉囊å??分ä¸?明顯 ... http://www.infochembio.ethz.ch/links/zool_saeuget_affenalt.html Altweltaffen: Säugetiere: Kleine Weissnasenmeerkatze (Cercopithecus petaurista) - Text. Kloss' Gibbon (Hylobates klossii) - Text. Kronenmeerkatze (Cercopithecus pogonias) - Text. ... http://www.mavicanet.ru/directory/eng/28451.html Hylobates - MavicaNET: ...[eng]. Select site, Sound Gallery: Hylobates klossii - English URL: http://www.tiho-hannover.de/gibbons/main/sound/02klos.html. Short ... http://www.mavicanet.ru/directory/rus/28451.html Hylobates - MavicaNET: ...[eng]. Выделить Ñ?айт, Sound Gallery: Hylobates klossii - English URL: http://www.tiho-hannover.de/gibbons/main/sound/02klos.html. ... http://www.blackwell-synergy.com/links/doi/10.1046/j.1439-0310.2003.00941.x/enhancedabs/ The Chorus Song of Cooperatively Breeding Laughing Kookaburras ...: StatSoft, Inc., Tulsa, OK. •, Tenaza, RR 1976: Songs, choruses and countersinging of Kloss' gibbon (Hylobates Klossii) in Siberut Island, Indonesia. ... http://www.kompas.com/kompas-cetak/0304/25/sorotan/274712.htm Kekayaan Mentawai Terancam Punah... - Jumat, 25 April 2003: ...hutan bakau dan ladang. Bilou atau Siamang Kerdil (Hylobates klossii). Ciri-ciri yang khas adalah bunyinya. Bunyi bilou paling indah ... http://bighost.area.ba.cnr.it/srs6bin/wgetz?%5Btaxonomy-ParentId:9578%5D+-e TAXONOMY:9579 ID : 9579 PARENT ID : 9578 RANK : species GC ID : 1 ...: COMMON NAME : gibbon // TAXONOMY:9587 ID : 9587 PARENT ID : 9578 RANK : species GC ID : 1 MGC ID : 2 SCIENTIFIC NAME : Hylobates klossii PREFERRED COMMON NAME ... http://bighost.area.ba.cnr.it/srs6bin/wgetz?-id+4lonX1L3D3P+-e+%5BTAXONOMY:'9587'%5D Entry Page: Link. Printer_Friendly, TAXONOMY:9587 ID : 9587 PARENT ID : 9578 RANK : species GC ID : 1 MGC ID : 2 SCIENTIFIC NAME : Hylobates klossii PREFERRED COMMON NAME ... http://www.mail-archive.com/primata@terranet.or.id/msg00028.html [primata] Kliping Primata - 24/Aug/01: File Format: Unrecognized - View as HTML ... wilayahnya ia cuma memperdengarkan nyanyian merdu. Di dunia binatang, siamang kerdil (Hylobates klossii) rupanya diciptakan sebagai. penyanyi unggul. ... http://www.booksmatter.com/b0933833342.htm Beacham's Guide to International Endangered Species: Crested [=Black] Gibbon. 57, (4). Hylobates hoolock. Hoolock Gibbon. 61, (3). Hylobates klossii. Kloss' [=Mentawai] Gibbon. 64, (3). Hylobates lar. Lar Gibbon. 67, (3). ... http://www.gpcr.org/7tm/seq/DR/Q9N249.TABDR.html GPCRDB Cross References for Q9N249: Description, Dopamine D4 receptor (Fragment). Gene, DRD4. Organism, Hylobates klossii (Kloss's gibbon). Chromosomal location, -. Gene Ontology, QuickGO. ... http://www.geometry.net/basic_g/gibbon_primates_page_no_4.php Geometry.Net - Basic_G: Gibbon Primates: As.. . 1. . P. Agile gibbon. Owa Ungko. 349. Hylobates klossii. . Mw. . . . . 1.E. http://www.bcpjica.org/Checklist_Mammals/PRIMATES_Hylobatidae.htm. ... http://www.geometry.net/detail/basic_g/gibbon_primates.html Geometry.Net - Basic_G: Gibbon Primates: ...or white-cheeked gibbon ( Hylobates concolor golden-cheeked gibbon ( Hylobates gabriellae hoolock gibbon ( Hylobates hoolock Hylobates klossii white-handed or ... http://www.savci.upol.cz/primati.htm Primates - Primáti: ...g. Å¡edý, hulok) - Hoolock Gibbon Hylobates klossii (Miller, 1903) - gibon malý - Kloss's Gibbon Hylobates lar (Linnaeus, 1771) - gibon lar (syn. ... http://web.gc.cuny.edu/Anthropology/news_studgrant.html News: Student Grants, Fellowships, and Prizes: Science Foundation Doctoral Dissertation Improvement Grant for "Evolutionary Genetics of Kloss's Gibbons (Hylobates Klossii): Systematics, Phylogeography, and ... http://www.worldhistory.com/wiki/g/gibbon.htm Gibbon: Lowland Agile Gibbon. Hylobates klossii, Kloss' Gibbon or Mentawai Gibbon; Hylobates lar: Hl lar, Malaysian Lar; Hl carpenteri, Carpenter's ... http://www.narmer.narod.ru/antra.htm \LARGE\bf ПроиÑ?хождение и Ñ?иÑ?тематика ...: Hylobates hoolock), черный, или одноцветный гиббон (Hylobates concolor-nomascus), гиббон КлоÑ?Ñ?а (Hylobates klossii). ... http://www.interaktv.com/mammals/Primates.html Biologybase: Mammals of the World: Primates: Hylobates concolor. Hylobates gabriellae. Hylobates hoolock. Hylobates klossii. Hylobates lar. Hylobates leucogenys. Hylobates moloch. Hylobates muelleri. ... http://www.infobiogen.fr/db/index-lassap/sptrembl/mam.seq Q9N1N1 #AC Q9N1N1; #OS PAPIO HAMADRYAS (HAMADRYAS BABOON). #DE ...: LCSLQIDSECTTIHYNFMCNSSCMGGMNRRPILTIITLEDSW >Q8WNF5 #AC Q8WNF5; #OS HYLOBATES KLOSSII (KLOSS'S GIBBON). #DE NPIP-LIKE PROTEIN (FRAGMENT). ... http://www.travellingtoindonesia.com/sumatra/siberut.htm Siberut Islands, Sumatra - Indonesia Travel Packages: Primates The magnificent call of the small black Kloss Gibbon or Bilou (Hylobates Klossii) is a striking feature of this primitive gibbon, Often heard echoing ... http://www.primate.org/support.htm Support: Danielle June Whittaker City University of New York Graduate Center $3,000.00 Conservation Biology of Kloss's Gibbons(Hylobates klossii). ... http://taxon.molgen.mpg.de/gettaxon?depth=3&prune=10000&taxid=9578 TAXON Query Form: Hylobates sp. (TaxID 9581, info); species: Hylobates klossii (TaxID 9587, info); species: Hylobates muelleri (TaxID 9588, info); species ... http://aquadb.nrifs.affrc.go.jp/~aquadb/cgi-bin/tax_hl.cgi?TTAXID=9587 Tax Data: Hylobates klossii, Hylobates klossi, Kloss's gibbon,, select language. jp. HELP. ... ddbj information. species(種), Hylobates klossii, ddbj information. ... http://val.cbi.pku.edu.cn/srs7bin/cgi-bin/wgetz?-id+4xSuA1LP_SQ+%5Btaxonomy-ParentId:9578%5D+-e [an error occurred while processing this directive] Hylobates klossii [an error occurred while processing this directive] 10547 Dwarf Gibbon, Kloss's Gibbon, Mentawai Gibbon, Siamang De Kloss, Siamang Enano Dwarf Gibbon, Kloss's Gibbon, Mentawai Gibbon, Siamang De Kloss, Siamang Enano Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |