|
|
Macaca nigrescens - Dumoga-Bone Macaque, Gorontalo MacaqueIUCN Status: Lower Risk/Conservation DependentIUCN Species Profile http://www.primates.com/classification/ Living Primates: Pig-tailed macaque; (Macaca nigra) Celebes ape; (Macaca nigrescens) Black ape; (Macaca radiata) Bonnet macaque; (Macaca silenus) Liontail ... http://home.globalcrossing.net/~brendel/primate.html PRIMATES (prosimians, monkeys, apes and humans): Macaca nemestrina (pigtailed macaque). Macaca nigra (Celebes ape). Macaca nigrescens (black ape). Macaca radiata (bonnet macaque). Macaca ... http://users.bart.nl/~edcolijn/redlistm.html Animal Redlist: Macaca nemestrina, Vulnerable. Macaca nigra, Endangered. Macaca nigrescens, Lower risk: conservation dependant. Macaca ochreata, Data deficient. ... http://www.origins.tv/darwin/zoo/oldmonk.htm Zoology -- Old World Monkeys: Northern Pigtail Macaque -- Macaca nigra -- Crested Black or Celebes Macaque -- [ *wisc | *ummz | *dutch | *szg | *tqj ] Macaca nigrescens -- Black Ape or ... http://en.wikipedia.org/wiki/Macaque Macaque - Wikipedia: Macaque, Macaca nigra; Black Ape or Gorontalo Macaque, Macaca nigrescens; Ochre Macaque, Macaca ochreata; Mentawai Macaque, Macaca ... http://www.netbiologen.dk/zoologi/primater.htm Familie Cheirogaleidae: Makak Macaca speciosa Macaca maurus Moor Makak Macaca mulatta Rhesus Makak Macaca nemestrina Pigtail Makak Macaca nigra Celebes abe Macaca nigrescens Sort abe ... http://www.yourencyclopedia.net/Macaca Online Encyclopedia - Macaca: Pig-tailed Macaque, Macaca nemestrina; Sulawesi Crested Macaque, Macaca nigra; Black Ape or Gorontalo Macaque, Macaca nigrescens; Ochre ... http://www.meitetsu.co.jp/japan-monkeycentre/primates/idx/idxsna-z.html Vol.36-43 Scientific Name Index: Macaca nigra.....36(3):423-429, 38(3):233-245. Macaca nigrescens.....38(3):233-245, 39(2):115-126. Macaca ochreata.....38(3):233-245. ... http://www.proz.com/?sp=h&id=105142 ProZ.com: KudoZ: A Translation Question: Macaca maurus) Moor macaque (Macaca mulatta) Rhesus macaque (Macaca nemestrina) Pigtail macaque (Macaca nigra) Celebes ape (Macaca nigrescens) Black ape ... http://www.nature-conservation.or.id/primates/primates_protected.html PROTECTED PRIMATES: Macaca nigrescens, SK Menteri Pertanian 421/Kpts/Um/8/1970 as Cynopithecus niger SK Menteri Kehutanan 301/Kpts-II/1991 as Cynopithecus niger Peraturan ... http://www.nature-conservation.or.id/primates/primates.html PRIMATES: Macaca nigrescens (Temminck, 1849); Macaca ochreata (Ogilby, 1841); Macaca pagensis (Miller, 1903); Macaca tonkeana (Meyer, 1899). Cercopithecidae ... http://www.geometry.net/basic_p/primates_endangered_&_threatened.php Geometry.Net - Basic_P: Primates Endangered & Threatened: ...deficient Macaca hecki Lower risk: near threatened Macaca maura Endangered Macaca nemestrina Vulnerable Macaca nigra Endangered Macaca nigrescens Lower risk ... http://www.worldguides.info/guides/portuguese/bali/bali-track-tourist-guides.html WorldGuides - Tourist & Travel Guides - Bali: ...- ... Quanto aos animais, há diferentes espécies em algumas classes: nos macacos distinguem-se a (macaca nigrescens, presbytis melalopos ea macaca fascicularis ... http://www.figweb.org/References/references_K.htm Ficus_references: 74:1831–1833. Kohlhaas, AK 1993. Behaviour And Ecology Of Macaca Nigrescens: Behavioural And Social Responses To The Environment And Fruit Availability. ... http://bighost.area.ba.cnr.it/srs6bin/wgetz?%5Btaxonomy-ParentId:9539%5D+-e TAXONOMY:9540 ID : 9540 PARENT ID : 9539 RANK : species GC ID : 1 ...: NAME : moor macaque // TAXONOMY:90384 ID : 90384 PARENT ID : 9539 RANK : species GC ID : 1 MGC ID : 2 SCIENTIFIC NAME : Macaca nigrescens // TAXONOMY:90385 ID ... http://www.unipv.it/webbio/api/pritaxfr.htm Tassonomia in francese: ...- ... crête (10) Macaca brunnescens macaque de Muna Macaca ochreata macaque de Célèbes à bras gris (10) Macaca nigra macaque nègre Macaca nigrescens macaque de ... http://www2.bonet.co.id/dephut/pel3.htm Pel3: Pengaruh tekstur tanah terhadap pertumbuhan beberapa bibt jenis tumbuh cepat (1982) 392 BISMARK, M.: Ekologi dan tingkah laku Macaca nigrescens di Suaka ... http://users.wired.net.au/susan/sullist.htm SULlist: ...at Tangkoko. Sulawesi Black Macaque Macaca nigrescens E, less common than the above species at Bogani Nani Wartabone. Sulawesi Wild ... http://www.infobiogen.fr/db/embl-align/ALIGN_000239.dat ID ALIGN_000239; DNA; 600 symbols (32 sequences) XX AC ...: ...maura AF284308 Macaca maura SO 14 14_M.mulat AF284309 Macaca mulatta SO 15 15_M.nigra AF284318 Macaca nigra SO 16 16_M.nigre AF284319 Macaca nigrescens SO 17 ... http://www.infobiogen.fr/db/cutg/CUTG/gbpri.spsum Allenopithecus nigroviridis: 1 1 5 6 0 2 2 0 23 29 1 0 3 2 8 0 0 ...: ...- ... 0 16 6 4 8 6 0 6 3 2 4 0 0 4 8 0 1 0 4 2 0 6 6 0 5 4 2 0 2 6 0 0 0 0 0 10 2 2 0 6 0 2 2 0 2 4 4 6 0 1 6 14 17 7 4 0 2 0 0 mitochondrion Macaca nigrescens: 1 0 ... http://nl.wikipedia.org/wiki/Primates_(taxonomie) Primates (taxonomie) - Wikipedia NL: Ondersoort: Macaca nemestrina nemestrina. Soort: Macaca nigra; Soort: Macaca nigrescens; Soort: Macaca ochreata; Soort: Macaca pagensis; ... http://taxon.molgen.mpg.de/gettaxon?depth=3&prune=10000&taxid=9528 TAXON Query Form: TaxID 90382, info); species: Macaca maura (TaxID 90383, info); species: Macaca nigrescens (TaxID 90384, info); species: Macaca ochreata ... http://www.earthscape.org/t1/wie01/wallacea.html Conserving Earth's Biodiversity with EO Wilson: ...levels of mammalian endemism in Asia, including species such as the Sulawesi wild pig (Babyrousa babyrussa) and the black-crested macaque (Macaca nigrescens). ... http://exon.bic.nus.edu.sg/~meena/sege/gb128/gbpri8.101 44924_AE006463 Homo sapiens 16p13.3 sequence section 2 of 8.! ...: 98) MIPTYMNIMLAFTISLLGMLTYRSHLVASLLCLEGMMMSLFIMATLIASNTHFPLINIMPIILLVFAACEAAVGLALLISISNTYGLDYIHNLNLLQC > 45112_AF091410 Macaca nigrescens NADH dehydrogenase ... http://www.chickest.udel.edu/orthomouse/m374.html BLAST Search Results: 102 5e-20 gb|AF284320.2|AF284320 Macaca ochreata SRY (SRY) gene, part... 102 5e-20 gb|AF284319.2|AF284319 Macaca nigrescens SRY (SRY) gene, pa... ... http://www.chickest.udel.edu/orthochick/c374.html BLAST Search Results: 103 3e-20 gb|AF284320.2|AF284320 Macaca ochreata SRY (SRY) gene, part... 102 4e-20 gb|AF284319.2|AF284319 Macaca nigrescens SRY (SRY) gene, pa... ... http://xenopus.nibb.ac.jp/cgi-bin/getCloneBlast?XL008p14 Clone XL008p14 [sequences]: ...gi|850997|gnl|db|gp:AF284268_1, 79, 33, 0.88, 12-176, 94-139, +3, 159, [AF284268] gi:11528196 testis-specific protein [Macaca nigrescens]. ... http://xenopus.nibb.ac.jp/cgi-bin/getCloneBlast?XL016g23 Clone XL016g23 [sequences]: ...gi|850997|gnl|db|gp:AF284268_1, 81, 55, 6e-07, 494-661, 1-56, +2, 159, [AF284268] gi:11528196 testis-specific protein [Macaca nigrescens]. ... http://gb.ettoday.com.tw:6060/2003/03/12/738-1424035.htm 高市ï¼?寿山动物å›æ€€å®?è—?稀有黑猕猴身价ä¸?凡: ...而寿山动物å›çŽ°åˆ™æ‹¥æœ‰4个å“?ç§?（Macaca nigra（黑 å† çŒ´ï¼‰ã€?Macaca nigrescensã€?Macaca hecki以å?ŠMacaca maura ... http://csc-fserve.hh.med.ic.ac.uk/srs6bin/cgi-bin/wgetz?%5Bsptrembl-ID:Q9XL49%5D+-e General: Description, nadh dehydrogenase subunit 4 (EC 1.6.5.3) (nadh-ubiquinone oxidoreductase chain 4) (fragment). Organism source, Macaca nigrescens. ... http://www.cureparalysis.org/abstracts/3/nih35.html Molecular Evolution of Human and Simian T-Cell Lymphotropic Virus ...: Cercocebus atys, Macaca fascicularis, Macaca nemestrina, Macaca arctoides, Macaca mulatta, Macaca radiata, Macaca silenus, Macaca sinica, and Macaca nigrescens ... http://aquadb.nrifs.affrc.go.jp/~aquadb/cgi-bin/tax_hl.cgi?TTAXID=9540 Tax Data: ...species(種), Macaca maura, ddbj information. species(種), Macaca nigrescens, ddbj information. species(種), Macaca ochreata, ddbj information. ... http://genstyle.imed.jussieu.fr/chaosgame/affichage_esp_list.php?lettres=m Alphabetical List of Species: ...- ... Macaca maura (1). Macaca mulatta (1). Macaca nemestrina (52). Macaca nigra (3). Macaca nigrescens (1). Macaca ochreata (1). Macaca radiata (13). Macaca silenus (2). ... http://genome.jgi-psf.org/cgi-bin/dispGeneModel.v4?db=whiterot1&id=67643 Protein Pages: Phanerochaete chrysosporium (White Rot fungus): ...genome.jgi-psf.org/cgi-bin/ dispGeneModel.v4?db=whiterot1&id=67643 - 24k - Cached - Similar pages C27B7.1 ... protein [Cercopithecus pogonias]. AAG37161.1, 25, 136, 4.00e-07, 61, 194, 4, 139, testis-specific protein [Macaca nigrescens]. AAG37128.1, 25, ... http://sgce.cbse.uab.edu/cgi-bin/text_blast_server.py?PW=11-D3&DB=nr C27B7.1: ...protein [Cercopithecus pogonias]. AAG37161.1, 25, 136, 4.00e-07, 61, 194, 4, 139, testis-specific protein [Macaca nigrescens]. AAG37128.1, 25, ... http://sgce.cbse.uab.edu/sgce/Blastnr/p011/11-D3.blastnr BLASTP 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas ...: Macaca nigra] 58 2e-07 gb|AAL09274.1| testis-specific protein [Cercopithecus pogonias] 58 3e-07 gb|AAG37161.1| testis-specific protein [Macaca nigrescens] 57 4e ... http://www.cse.ucsc.edu/research/compbio/yeast-protein-predictions/YKR0/YKR048C/YKR048C.t2k.pa.html a2m2html output for file tmp.a2m: ...gi|11528196|gb|AAG37161.1|_1:138 testis-specific protein [Macaca nigrescens]. gi|11528208|gb|AAG37167.1|_1:138 testis-specific protein [Macaca sylvanus]; ... http://www.geocities.com/mikeshanahan/figs/FIGREFS.html Fig-eating review: References: KOHLHAAS, AK (1993). Behaviour and Ecology of Macaca nigrescens: Behavioural and Social Responses to the Environment and Fruit Availability. ... http://bioinfo.hku.hk/db/cutg/gbpri.spsum Alouatta belzebul: 2 0 0 0 0 2 5 1 6 20 2 0 5 0 6 1 5 4 4 2 7 0 7 ...: ...- ... 0 16 6 4 8 6 0 6 3 2 4 0 0 4 8 0 1 0 4 2 0 6 6 0 5 4 2 0 2 6 0 0 0 0 0 10 2 2 0 6 0 2 2 0 2 4 4 6 0 1 6 14 17 7 4 0 2 0 0 Mitochondrion Macaca nigrescens: 1 0 ... http://www.hamline.edu/apakabar/basisdata/1994/10/07/0003.html Taman Nasional Nani Wartabone: ...anoa dataran rendah (Kubalus depscicornnis), anoa dataran tinggi (Babalus quarlesi), tangkasi (Tarsius Spectrum), yakis (Macaca nigra-nigra, Macaca nigrescens ... http://walnut.bioc.columbia.edu/srs6bin/cgi-bin/wgetz?-id+on291EKHQt+%5Bsptrembl-ID:Q9GKB1%5D+-e [an error occurred while processing this directive] Macaca nigrescens [an error occurred while processing this directive] 12568 Dumoga-Bone Macaque, Gorontalo Macaque Dumoga-Bone Macaque, Gorontalo Macaque Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |