|
|
Macropus eugenii - Tammar WallabyIUCN Status: Lower Risk/Near ThreatenedIUCN Species Profile http://www.scz.org/animals/w/wallaby2.html Dama Wallaby - Macropus eugenii: Select a Mammal. ... http://www.redlist.org/search/details.php?species=12638 IUCN Red List of Threatened Species - Macropus eugenii ssp. ...: Macropus eugenii ssp. eugenii. Taxonomy. ... Biome, Terrestrial. Detailed Documentation. Range and Population, Macropus eugenii eugenii is endemic to Australia. ... http://www.itis.usda.gov/servlet/SingleRpt/SingleRpt?search_topic=TSN&search_value=552731 ITIS Standard Report Page: Macropus eugenii: Go to Print Version, Macropus eugenii (Desmarest, 1817) Taxonomic Serial No.: 552731. ... Species, Macropus eugenii (Desmarest, 1817) -- Tammar wallaby, References, ... http://www.itis.usda.gov/servlet/SingleRpt/RefRpt?search_type=publication&search_id=pub_id&search_id_value=172 ITIS 'Publication' Search results for Nowak, Ronald M.: Macropus dorsalis (Gray, 1837) -- valid -- black-striped wallaby. Macropus eugenii (Desmarest, 1817) -- valid -- Tammar wallaby. Macropus ... http://www.animals-online.be/marsupials/kangoeroes/tammar_wallaby.html Tammar Wallaby (Macropus eugenii): Fact Sheet: Scientific name. Macropus eugenii. English name. Tammar Wallaby. Nederlandse naam. Tammar Wallabie. Nom Français. Wallaby de l´ile d´Eugène. Deutsche name. ... http://brainmuseum.org/Specimens/marsupalia/tammar/ Comparative Mammalian Brain Collections: Tammar (Macropus eugenii): Tammar (Macropus eugenii) #64-33. ... Tammar Macropus eugenii Head and body length of Macropus genus is 400-1,050 mm and tail length is from 330-750 mm. ... http://brainmuseum.org/Specimens/linearlist.html Comparative Mammalian Brain Collections: Linear List of Specimens: Potorous tridactylus); Tammar (Macropus eugenii); Gray Kangaroo (Macropus fuliginosus); Bennett's wallaby (Macropus rufogriseus); Red ... http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&list_uids=9750967&dopt=Abstract Embryonic globins of the marsupial the Tammar Wallaby (Macropus ...: Embryonic globins of the marsupial the Tammar Wallaby (Macropus eugenii): bird like and mammal like. Holland RA, Gooley AA, Hope RM. ... http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Retrieve&list_uids=8445660&dopt=Citation Cranial osteogenesis in Monodelphis domestica (Didelphidae) and ...: Cranial osteogenesis in Monodelphis domestica (Didelphidae) and Macropus eugenii (Macropodidae). Clark CT, Smith KK. Department ... http://merops.sanger.ac.uk/speccards/peptidase/sp001029.htm Peptidase of Macropus eugenii (tammar wallaby): Macropus eugenii (tammar wallaby). TAXONOMY. Taxonomy database identifier: 9315. Superkingdom, Eukaryota. Kingdom, Animalia. Subkingdom, Metazoa. Phylum, Chordata. ... http://tiermagazin.naturecom.de/text/derbywallaby.html Derbywallaby (Macropus eugenii): ...- wissenschaftlicher Name: Macropus eugenii englischer Name: Tammar wallaby französischer Name: Wallaby de l´ile d´Eugène Familie: Eigentliche Känguruhs ... http://encyclopedia.thefreedictionary.com/Macropus%20eugenii encyclopedia.thefreedictionary.com/Macropus%20eugenii: Similar pages Macropsia - encyclopedia article about Macropsia. Free access, no ...Macropsia. Word: Word. Macropsia is a neurological condition affecting human perception, in which ... http://encyclopedia.thefreedictionary.com/Macropsia Macropus eugenii: Macropus eugenii Tammar (or Dama, Scrub) Wallaby ダマヤブワ ラビー 分類. 目：Marsupialia（Marsupials, 有袋目） 科 ... http://1kai.dokkyomed.ac.jp/mammal/en/species_all/macropus_eugenii.html Macropus eugenii: Macropus eugenii Tammar (or Dama, Scrub) Wallaby Classification. Order: Marsupialia (Marsupials) Family: Macropodidae (Kangaroos ... http://content.karger.com/ProdukteDB/produkte.asp?Aktion=ShowFulltext&ProduktNr=224037&Ausgabe=229862&ArtikelNr=75764 Karger Publishers: ...evolution, the chromosome number first increased from the 2n = 14 ancestral set to 2n = 22, then decreased to for instance 2n = 16 in Macropus eugenii, 2n = 14 ... http://www.bireme.com.au/Supporter/AboutGBLiu/MyWeb/Publications.htm Papers: 2. Liu GB (2003) Functional development of the auditory brainstem in the tammar wallaby (Macropus eugenii): the superior olivary complex and its relationship ... http://jeb.biologists.org/cgi/content/figsonly/204/23/4031 JEB -- Miller et al. 204 (23): 4031: Download to Citation Manager. Postnatal development and control of the pulmonary surfactant system in the tammar wallaby Macropus eugenii. ... http://jeb.biologists.org/cgi/content/abstract/204/23/4031 JEB -- Summaries: Miller et al. 204 (23): 4031: Biologists Limited. Postnatal development and control of the pulmonary surfactant system in the tammar wallaby Macropus eugenii. Natalie J ... http://www.ava.com.au/content/avj/feb97/141.htm AVJ 75,2,Feb'97 pp 141-: Serum analytes in the Tammar wallaby, Macropus eugenii. EM DEANE a *, K BASDEN a , L BURNETT b , A PROOS b , DW COOPER c. a Department ... http://cvs.anu.edu.au/ann_rep93/confs.html CONFERENCES: Ding Y, Marotte LR. Retinotopic order of optic axons during the formation of the retinocollicular projection in the wallaby Macropus eugenii. ... http://cvs.anu.edu.au/report98/confer.html CVS 97/98 Conference Papers: Proc Aust Neurosc Soc 8, 28; Hemmi JM, Maddess T, Mark RF (1997) Spectral sensitivities of the photoreceptors in the tammar wallaby (Macropus eugenii). ... http://www-dsv.cea.fr/thema/MitoPick/Search/Macropus_eugenii.html Result for Macropus eugenii: ...- Your specific search result is: name of the subunit. Family name/other name. gene localization. NU1M_MACEU, ND1 subunit, Mitochondria. ... http://animalwelfare.massey.ac.nz/AWSBC%20publications.htm AWSBC Publications: Springett BP, and Haslett S. Factors Affecting the Volume and Macrostructure of Gastrointestinal Compartments in the Tammar Wallaby (Macropus Eugenii Desmarest ... http://www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=Macropus+eugenii+%5Bgbmam%5D Codon usage table: Macropus eugenii [gbmam]: 38 CDS's (10453 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU 20.4( 213) UCU 18.3 ... http://www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=mitochondrion+Macropus+eugenii+%5Bgbmam%5D Codon usage table: ...mitochondrion Macropus eugenii [gbmam]: 1 CDS's (319 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU 25.1( 8) UCU ... http://www.newcastle.edu.au/discipline/biology/staff/profile/minjie_prof.html The Discipline of Biological Science: ...localisation of thiol and disulphide groups by direct Monomaleimido-Nanogold labelling in the spermatozoa of a marsupial the tammar wallaby (Macropus eugenii). ... http://www.newcastle.edu.au/discipline/biology/marsupialcrc/edutrain.html Education and Training: Honours students. MACQUARIE Jennifer Cummings Microsatellite analysis of the mating system of the tammar wallaby (Macropus eugenii) Supervisor: Prof D Cooper. ... http://www.ew.govt.nz/policyandplans/rpmsintro/rpms2002/operative6.2.1.htm EW - Waikato Regional Pest Management Strategy/6 Animal Pests/6.2 ...: 6 Animal Pests. 6.2 Eradication (Service Delivery) Animal Pests. 6.2.1 Dama Wallaby (Macropus eugenii). Description The dama wallaby ... http://www.cureparalysis.org/abstracts/csa2.html Development of the brachial spinal cord in the marsupial Macropus ...: Cure Paralysis Now. TI: Title Development of the brachial spinal cord in the marsupial Macropus eugenii (tammar wallaby). AU: Authors ... http://www.funet.fi/pub/sci/bio/life/mammalia/marsupalia/macropodidae/macropus/ Macropus: See [About maps]. Macropus eugenii (Desmarest, 1817) eugenii (Desmarest, 1817); Nouv. Dict. Hist. Nat., nouv. ... Peter's Island Macropus eugenii ; [MSOW], 46 ... http://www.zoology.unimelb.edu.au/staff/nicholas.htm Dr Kevin Nicholas, Principal Research Fellow, Department of ...: K. (1998) Developmentally-regulated expression of a putative protease inhibitor gene in the lactating mammary gland of the tammar wallaby, Macropus eugenii. ... http://www.zoology.unimelb.edu.au/staff/fletcher.htm Dr.Terry Fletcher, Senior Lecturer, Department of Zoology: P., Fletcher, TP and Renfree, MB Testicular development and maturation of the hypothalamic-pituitary-testicular axis in the male tammar, Macropus eugenii. ... http://www.deh.gov.au/biodiversity/trade-use/publicnotices/archive/draft-tor/tamar-wallaby.html Draft Terms of Reference for a report assessing the impact of ...: Draft Terms of Reference for a report assessing the impact of importing Tammar wallabies Macropus eugenii eugenii from Kawau Island, New Zealand. ... http://www.deh.gov.au/biodiversity/threatened/action/marsupials/13.html Action Plan for Australian Marsupials and Monotremes - Recovery ...: Recovery Outline. Tammar Wallaby (SA). 1 Family: Macropodidae. 2 Scientific name: Macropus eugenii eugenii (Desmarest, 1817). 3 Common name: Tammar Wallaby (SA). ... http://www.ahs.cqu.edu.au/ahsfaculty/cbs/staff/lauren_young.htm Dr Lauren Young: Harrison, G. A., Broughton, MJ, Young, LJ, Deane, EM (1999). Conservation of 3¢ untranslated region elements in tammar wallaby (Macropus eugenii) TNF-a mRNA. ... http://www.fact-index.com/m/ma/macropod.html Macropod: ...dorsalis; Tammar Wallaby: Macropus eugenii; Western Grey Kangaroo: Macropus fuliginosus; Eastern Grey Kangaroo: Macropus gigantues; ... http://members.fortunecity.fr/kangourou/wal_eugene.htm wal_eugene: ...- ... Genre et espèce Macropus Eugenii. Nom anglais : Tammar Wallaby. Nom scientifique : Macropus Eugenii. Aussi appelé Tammar ou wallaby de dama. ... http://www.sc.mahidol.ac.th/scps/images/picture/CV&image-staff/ganyapong/ganyapong.htm ganyapong: Chaturapanich, G., Jones, RC (1991). Morphometry of the epididymis of the tammar wallaby, Macropus eugenii, and estimation of some physiological parameters. ... http://www.marsupialsociety.org/members/html/01sp04.html Keeping Marsupials : Keeping and Breeding Marsupials in Captivity ...: The Dama or Tammar Wallaby (Macropus eugenii) is without doubt the most commonly kept marsupial in Australia, being even easier to keep than it’s ... http://www.marsupialsociety.org/checklist2.html Keeping Marsupials : Keeping and Breeding Marsupials in Captivity ...: Macropus agilis. Black-striped Wallaby. Macropus dorsalis. Dama Wallaby. Macropus eugenii. Toolache Wallaby. Macropus greyi. Western Brush Wallaby. Macropus irma. ... http://www.shoarns.com/Wallaby.htm Tammar Wallabies at Featherdale: Albino Tammar Wallabies. (Macropus Eugenii). . Wallaby ... conception. "Macropus eugenii is a very important animal in scientific research . . . ... http://www.apus.ru/site.xp/055050056124050055057056124.html APUS.RU | Таммар, или куÑ?тарниковый ...: Таммар, или куÑ?тарниковый валлаби - Macropus eugenii - Ñ?то Ñ?амый мелкий из валлаби, длина его ... http://www.blackwell-synergy.com/links/doi/10.1046/j.1460-9568.2000.00251.x/enhancedabs/ Graded expression of EphA3 in the retina and ephrin-A2 in the ...: ...retina and the superior colliculus during the development of the retinocollicular projection in the marsupial wallaby (Macropus eugenii), using immunoblotting ... http://www.blackwell-synergy.com/links/doi/10.1111/j.0001-7272.2004.00157.x/enhancedabs/ Observations of spermiogenesis and epididymal sperm maturation in ...: ..., Lin, M., Harman, A. and Rodger, JC 1997. Spermiogenesis and spermiation in a marsupial, the Tammar Wallaby (Macropus eugenii). ... http://www.conservation.bio.mq.edu.au/pubs/dwc.html ANZCoL Publications by Professor Des Cooper: Zenger KR, McKenzie LM, Cooper DW. (2002). The first comprehensive genetic linkage map of a marsupial: the tammar wallaby (Macropus eugenii). Genetics. ... http://www.acapixus.dk/galleri/slides/27.htm AcaPixus - Index over analoge billeder: KOL2621 / 36x24 / Damakænguru (Macropus eugenii, Macropodidae) WildWorld / Cairns / Queensland / Australien KOL2622 / 24x36 / Damakænguru (Macropus eugenii ... http://www.ingenta.com/isis/searching/ExpandTOC/ingenta?issue=pubinfobike://csiro/zo/2004/00000052/00000001&index=5 Ingenta: Article Summary -- Temporal aspects of feeding events in ...: Temporal aspects of feeding events in tammar (Macropus eugenii) and parma (Macropus parma) wallabies. I. Food acquisition and oral ... http://www.ingenta.com/isis/searching/ExpandTOC/ingenta?issue=pubinfobike://ap/gc/2002/00000125/00000001&index=11 Ingenta: Article Summary -- Developmental Profile of Thyroid ...: Developmental Profile of Thyroid Hormone Distributor Proteins in a Marsupial, the Tammar Wallaby Macropus eugenii General and Comparative Endocrinology January ... http://www.viridans.com.au/RAREAN/Sam0222.htm Tammar Wallaby: Tammar Wallaby - Macropus eugenii. General Appearance: A wallaby with dark grizzled grey-brown fur above, becoming rufous on the sides of the body. ... http://en.wikipedia.org/wiki/Macropod Macropod - Wikipedia, the free encyclopedia: ...antilopinus; Black Wallaroo: Macropus bernadus; Black-striped Wallaby: Macropus dorsalis; Tammar Wallaby: Macropus eugenii; Western ... http://en.wikipedia.org/wiki/Wallaby Wallaby - Wikipedia, the free encyclopedia: ...dorsalis; Tammar Wallaby: Macropus eugenii; Toolache Wallaby: Macropus greyii (extinct); Western Brush Wallaby: Macropus irma; Parma ... http://www.biolsci.monash.edu.au/labs/taylor/PubList.html Publications by Dr. Gerry Quinn: Sunnucks P, AC Taylor (1997) Gender of pouch young related to maternal weight in Macropus eugenii and M. parma (Marsupialia: Macropodidae). ... http://library.uws.edu.au/adt-NUWS/public/adt-NUWS20030828.145055/ University of Western Sydney <ADT> Public View: ...adt logo, Australian Digital Theses Program. Thesis Details. Title, T-cell development in the Tammar wallaby (Macropus eugenii). Author, Zuccolotto, Peter. ... http://www.life.sci.qut.edu.au/collet/misc/cv_pubs.html tp_template: McKenzie LM, Poole WE, Collet C, Cooper DW: Higher female than male recombination rates in a marsupial mammal, the tammar wallaby (Macropus eugenii). ... http://www.biomedcentral.com/pubmed/12604644 Maternal regulation of milk composition, milk production, and ...: ...here to read Maternal regulation of milk composition, milk production, and pouch young development during lactation in the tammar wallaby (Macropus eugenii ). ... http://exon.bic.nus.edu.sg/~meena/sege/gb130/gbmam.output 1_AAMC1R DEFINITION Alces alces MC1-R gene. ORGANISM Ovibos ...: 21_AB011221 DEFINITION Macropus eugenii mitochondrial ND1 gene for NADH dehydrogenase subunit 1 , complete cds. ORGANISM Macropus ... http://exon.bic.nus.edu.sg/~meena/sege/gb128/gbmam.101 14139_AAMC1R Alces alces MC1-R gene.!Nuclear !Orgn:Ovibos ...: 14159_AB011221 Macropus eugenii mitochondrial ND1 gene for NADH dehydrogenasesubunit 1 , complete cds.!Nuclear !Orgn:Macropus eugenii =nid(g3399746) =axn ... http://www.genomesize.com/cellsize/mammals.htm Mammal cell sizes: Dendrolagus inustus, 7.4, 1. Macropus dorsalis, 8.2, 3. " ", 6.5, 15. Macropus eugenii, 7.5, 1, 71, 16. Macropus fuliginosus, 7.4, 1. Macropus giganteus, 7.6, 1. ... http://www.ciencia.net/VerArticulo/Macropodidae?idArticulo=dsfjukn7138be9qnwhanl170 Macropodidae - Ciencia.net - Noticias cientÃficas, artÃculos ...: ...- ... Macropus antilopinus; Macropus bernardus; Macropus dorsalis; Macropus eugenii; Macropus fuliginosus; Macropus giganteus; Macropus greyi; ... http://www.environment.sa.gov.au/parks/sealbay/natural.html Seal Bay Conservation Park - Natural Attractions: Tammar Wallaby (Macropus eugenii). ... Please do not feed the animals. When you visit Seal Bay, be on the lookout for Tammar Wallabies Macropus eugenii. ... http://www.biochemj.org/bj/241/bj2410899.htm Biochem. J. (1987) 241, 899-904 - Nicholas KR and Others - A novel ...: Britain). A novel whey protein synthesized only in late lactation by the mammary gland from the tammar (Macropus eugenii). Nicholas ... http://beheco.oupjournals.org/cgi/content/abstract/11/5/528 Behavioral Ecology -- Abstracts: Blumstein et al. 11 (5): 528: ...for Behavioral Ecology Insular tammar wallabies (Macropus eugenii) respond to visual but not acoustic cues from predators. Daniel T ... http://www.uni-duesseldorf.de/MedFak/mai/n_publ.htm Neuroanatomie: Publications: Publikationen: 2002: Cheng G. Marotte LR, Mai JK, Ashwell KWS: Early development of the hypothalamus of a wallaby (Macropus eugenii). J. Comp. Neurol. ... http://www.uni-duesseldorf.de/MedFak/mai/en_publications.htm Neuroanatomie || Arbeitsgruppe Mai: ...top. • Publications 2002: Cheng G. Marotte LR, Mai JK, Ashwell KWS: Early development of the hypothalamus of a wallaby (Macropus eugenii). J. Comp. Neurol. ... http://www.photomazza.com/table.php?table=2&do_theme=true&theme=M Species: ...- ... MACACA, SYLVANA, 54, CERCOPITHECIDAE. MACROPUS, AGILIS, 2, MACROPODIDAE. MACROPUS, EUGENII, 3, MACROPODIDAE. MACROPUS, FULIGINOSUS FULIGINOSUS, 26, MACROPODIDAE. ... http://www.amonline.net.au/evolutionary_biology/staff/teenab.htm Evolutionary Biology - Teena Browning: I have identified two MHC class II genes and I am currently characterising the diversity at these 2 genes in the tammar wallaby (Macropus eugenii). ... http://www.amonline.net.au/display.cfm?id=1566 Australian Museum - What Makes a Wallaby Jump?: ...new study has revealed that, despite living in such idyllic conditions for thousands of generations, the island's Tammar Wallabies (Macropus eugenii) can still ... http://www.terrambiente.org/fauna/Mammiferi/metatheria/diprotodontia/ Diprotodonti: ...- ... Macropus, macropus_rufus.jpg (70625 byte), Macropus agilis, Macropus antilopinus, Macropus bernardus, Macropus dorsalis, Macropus eugenii. ... http://www.molvis.org/molvis/v3/a9/ Segovia, Mol Vis 1997; 3:9.: A peptide, (ESGDVILSGAEIFAELGEVVK), taken from the original protein microsequencing of Macropus eugenii µ-crystallin (8), was synthesized at the UCLA ... http://www.emporia.edu/biosci/msl/diproto.htm MSL, Order Diprotodontia: Victoria, Australia, 1979. HJ Aslin Macropus eugenii - Tammar wallaby - Australia; 203 Side view, Melbourne Zoo, Australia, 1976. EC Oaks ... http://anatomy.med.unsw.edu.au/ashwell/ashwell.htm Department of Anatomy - Ashwell Lab: KWS, Waite, PME & Marotte, L. (1996) Ontogeny of the projection tracts and commissural fibres in the forebrain of the wallaby (Macropus eugenii): A comparison ... http://www.press.jhu.edu/books/walkers_mammals_of_the_world/marsupialia/images/image.marsupialia.macropodidae.macropus.html Thumbnails Page, Marsupialia Macropodidae Macropus: ...larger image). Tammar wallaby (Macropus eugenii), photo by LF Schick / National Photographic Index of Australian Wildlife. Red-necked ... http://www.blackwellpublishing.com/issue.asp?ref=0021-8782&vid=201&iid=3&oc=joa20103&s=&site=1 Journal of Anatomy Issue: 239, The development of the gubernaculum and inguinal closure in the marsupial Macropus eugenii D. Coveney, G. Shaw, JM Hutson and MB Renfree. ... http://www.duke.edu/~kksmith/cranial_osteogenesis_abstract.html Cranial Osteogenesis Abstract: Clark, CT and KK Smith. 1993. Cranial osteogenesis in Monodelphis domestica (Didelphidae) and Macropus eugenii (Macropodidae). Journal of Morphology. ... http://robetta.bakerlab.org/results.jsp?id=576&p=18 Robetta Structure Prediction Server Job 576 Results - hgfsfk4: ...fragments). 9315, Macropus eugenii, 1 (0.34%), 1E-29, 2-84, 369-450, 129, 41, 83, gi|2305256|gb|AAB65760.1|, plasminogen [Macropus eugenii]. ... http://getentry.ddbj.nig.ac.jp/cgi-bin/get_entry.pl?AY286018 Get Entry: LOCUS AY286018 1463 bp mRNA linear MAM 29-SEP-2003 DEFINITION Macropus eugenii medium wave-sensitive opsin 1 (OPN1MW) mRNA, complete cds. ... http://getentry.ddbj.nig.ac.jp/cgi-bin/get_entry.pl?AY286017 Get Entry: LOCUS AY286017 1278 bp mRNA linear MAM 29-SEP-2003 DEFINITION Macropus eugenii short wave-sensitive opsin 1 (OPN1SW) mRNA, complete cds. ... http://sege.ntu.edu.sg/cgi-bin/extract_info.pl?dbase=gbmam&field=protein&pop=131&type=1 Your Search Results: E}VPEVTVFLKSPAMLGQPNTLI CFVDNIFPPVINVTWLKNRHSVTKGVSETSFLAKRDHSFLKISYLTFLPSADDIY > 56235_WALDNA11X Macropus eugenii MHC class II DN-alpha-1 gene (allele 1 ... http://www.nmnh.si.edu/msw/mammals_checklist.txt Monotremata Tachyglossidae Tachyglossus Tachyglossus aculeatus ...: Lagostrophus Lagostrophus fasciatus Macropus Macropus agilis Macropus antilopinus Macropus bernardus Macropus dorsalis Macropus eugenii Macropus fuliginosus ... http://www.bluep.com/~oco/Mammals2000.txt LAWRIE'S LIFE LIST OF AUSTRALIAN MAMMALS 27/9/2000 Platypus ...: Agile Wallaby Macropus agilis Antilopine Wallaroo Macropus antilopinus Black-striped Wallaby Macropus dorsalis Tammar Wallaby Macropus eugenii Western Grey ... http://www.cse.csiro.au/research/Program4/community_ecology/current_research/current_research_marsupials.htm CSIRO Sustainable Ecosystems - Research - Wildlife, Pests and ...: We are also studying the mechanisms that regulate reproduction in marsupials and use the Tammar wallaby, Macropus eugenii, as our model experimental species. ... http://www.rbej.com/search/results.asp?db=pm&terms=Harder_JD&field=AU Reproductive Biology and Endocrinology | Search results Harder_JD ...: ...corpus luteum, graafian follicle or ovaries on plasma progesterone, oestradiol, LH, parturition and post-partum oestrus in the tammar wallaby, Macropus eugenii ... http://birdingwa.iinet.net.au/sightings/sightings.htm Recent Sightings: Southern Brown Bandicoot (Isoodon obesulus) (1) Twertup Creek Honey Possum (Tarsipes rostratus) (10) Twertup Creek Tammar Wallaby (Macropus eugenii) (1) Old ... http://biology.unm.edu/biology/coccidia/marsup.html Coccidia of the World: 1989. Eimeria flindersi Barker, O'Callaghan, and Beveridge, 1989: Host: Macropus antilopinus (Antilopine wallaroo), Macropus eugenii (Tammar wallaby), Macropus ... http://classes.aces.uiuc.edu/AnSci308/marsupialslact.html Lactation in Marsupials: 1. Vombatidae. wombats. 3. Tarsipedidae. honey opossum. 1. Neonate Development. One of the most studied marsupial species is the Tammar Wallaby (Macropus eugenii). ... http://www.goodzoos.com/Marsupial.htm [an error occurred while processing this directive] Macropus eugenii [an error occurred while processing this directive] 41512 Tammar Wallaby Tammar Wallaby Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |