|
Macropus parryi - Whiptail WallabyIUCN Status: Lower Risk/Least ConcernIUCN Species Profile http://animaldiversity.ummz.umich.edu/site/accounts/classification/Macropus_parryi.html ADW: Macropus parryi: Classification: Macropus parryi (whiptail wallaby). Information; Pictures; Classification. What do these icons mean? ... Species Macropus parryi (whiptail wallaby). ... http://www.itis.usda.gov/servlet/SingleRpt/SingleRpt?search_topic=TSN&search_value=552737 ITIS Standard Report Page: Macropus parryi: Go to Print Version, Macropus parryi Bennett, 1835 Taxonomic Serial No.: 552737. ... Species, Macropus parryi Bennett, 1835 -- whiptail wallaby, References, Expert(s): ... http://www.itis.usda.gov/servlet/SingleRpt/RefRpt?search_type=publication&search_id=pub_id&search_id_value=172 ITIS 'Publication' Search results for Nowak, Ronald M.: ...wallaby. Macropus parma Waterhouse, 1846 -- valid -- Parma wallaby. Macropus parryi Bennett, 1835 -- valid -- whiptail wallaby. Macropus ... http://tiermagazin.naturecom.de/text/huebschgesichtwallaby.html Hübschgesichtwallaby (Macropus parryi): ...- wissenschaftlicher Name: Macropus parryi englischer Name: Pretty-faced wallaby französischer Name: Wallaby à belle face Familie: Eigentliche Känguruhs ... http://www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=Macropus+parryi+%5Bgbmam%5D Codon usage table: Macropus parryi [gbmam]: 1 CDS's (61 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU 0.0( 0) UCU 32.8( 2) UAU ... http://www.kazusa.or.jp/codon/M.html Alphabetical list: M: ...gbvrl]: 4 Macropus agilis [gbmam]: 1 Macropus eugenii [gbmam]: 38 Macropus fuliginosus [gbmam]: 2 Macropus giganteus [gbmam]: 2 Macropus parryi [gbmam]: 1 ... http://www.funet.fi/pub/sci/bio/life/mammalia/marsupalia/macropodidae/macropus/ Macropus: 47 Range: E.Queensland, NE.New South Wales. Macropus parryi Bennett, 1835 Macropus parryi Bennett, 1835; Proc. Zool. Soc. Lond. 1835 ... http://www.funet.fi/pub/sci/bio/life/warp/mammals-index-p.html All (in this database) Mammals list (Scientific names): ...see Pteronotus parnellii; parryi (Macropus); parryi (Spermophilus); parryi (Protemnodon), see Macropus parryi; Parryii (Arctomys), see ... http://www.painetworks.com/pages/en/en0234.html photo of pretty faced wallaby macropus parryi: ...home Image ID: en0234.JPG pretty faced wallaby macropus parryi Click on the butterfly to find similar images on our website, or, Click on the Home icon at the ... http://www.painetworks.com/cgi-bin/search.cgi?find=%20parry%20clover%20trifolium%20parryi%20&method=or Search Results: Image ID: ev2021 Keywords: shale barrens clover trifolium virginicum, Image ID: en0234 Keywords: pretty faced wallaby macropus parryi. ... http://www.vvm.com/~huckerby/DOCUMENTS/97of.html Table of Contents: ...research area. X.59. Figure X.3.2.19: Potential availability of Whiptail Wallaby (Macropus parryi) within the research area.X.60. Figure X ... http://www.vvm.com/~huckerby/DOCUMENTS/97toc.html Table of Contents: X.3.3.18. Yellow-footed Rock Wallaby (Petrogale xanthopus). X.3.3.19. Whiptail Wallaby (Macropus parryi). X.3.3.20. Black-striped Wallaby (Macropus dorsalis). ... http://www.genomesize.com/cellsize/mammals.htm Mammal cell sizes: Macropus eugenii, 7.5, 1, 71, 16. Macropus fuliginosus, 7.4, 1. Macropus giganteus, 7.6, 1. Macropus parryi, 6.5, 15. Macropus robustus, 8.0, 3. Macropus rufogriseus, 7.2, 1, 90, 4. ... http://www.bavarianbirds.de/oz/list.htm Birding East Coast Australia - Species List: Graues Riesenkänguruh, Common towards St. George and Girraween National Park. Whiptail Wallaby (Macropus parryi) Hübschgesichtwallaby, Some around Kingaroy. ... http://www.ciencia.net/VerArticulo/Macropodidae?idArticulo=dsfjukn7138be9qnwhanl170 Macropodidae - Ciencia.net - Noticias cientÃficas, artÃculos ...: ...- ... giganteus; Macropus greyi; Macropus irma; Macropus parma; Macropus parryi; Macropus robustus; Macropus rufogriseus; Macropus rufus. Petrogale ... http://fr.wikipedia.org/wiki/Kangourou Kangourou - Wikipédia: ...- ... agilis); Wallaby de Parry (macropus parryi); Wallaby à raie noir (macropus dorsalis); Wallaby de Bennett (macropus rufogriseus); Wallaby ... http://www.photomazza.com/table.php?table=2&do_theme=true&theme=M Species: ...- ... MACROPUS, GIGANTEUS, 35, MACROPODIDAE. MACROPUS, PARMA, 8, MACROPODIDAE. MACROPUS, PARRYI, 15, MACROPODIDAE. MACROPUS, ROBUSTUS ERUBESCENS, 19, MACROPODIDAE. ... http://www.terrambiente.org/fauna/Mammiferi/metatheria/diprotodontia/ Diprotodonti: ...- ... Macropus fuliginosus, Macropus giganteus, Macropus greyi, Macropus irma, Macropus parma, Macropus parryi, Macropus robustus, Macropus rufogriseus, Macropus ... http://www.publish.csiro.au/nid/144/paper/WR97128.htm CSIRO PUBLISHING - Wildlife Research: Reproduction of the whiptail wallaby, Macropus parryi Bennett (Marsupialia : Macropodidae), in captivity with age estimation of the pouch-young PM Johnson ... http://www.marsupialsociety.org/checklist2.html Keeping Marsupials : Keeping and Breeding Marsupials in Captivity ...: Macropus irma. Parma Wallaby. Macropus parma. Whiptail Wallaby. Macropus parryi. Red-necked Wallaby. Macropus rufogriseus. Red Kangaroo. Macropus rufus. ... http://www.emporia.edu/biosci/msl/diproto.htm MSL, Order Diprotodontia: Sanctuary, Tasmania, 1999. JA Lackey Macropus parryi - Whiptail wallaby - E Queensland, NE New South Wales, Australia; 726 Front view ... http://www.press.jhu.edu/books/walkers_mammals_of_the_world/marsupialia/images/image.marsupialia.macropodidae.macropus.html Thumbnails Page, Marsupialia Macropodidae Macropus: Zoological Society. Whiptail wallaby (Macropus parryi), photo by IR McCann / National Photographic Index of Australian Wildlife. Western ... http://www.press.jhu.edu/books/walkers_mammals_of_the_world/refs/walker.ref-k.html Literature Cited, K: Zool. 60:95-222. ___. 1974. Social ethology of the whiptail wallaby, Macropus parryi, in northeastern New South Wales. Anim. Behav. 22:281-369. ___. 1975. ... http://www.mareebawetlands.com/mammallist.html MAMMALS - The Mareeba Tropical Savanna and Wetlands Reserve: 1, 4, 7. Unadorned Rock Wallaby. Petrogale mareeba. 1. Whiptail Wallaby. Macropus parryi. 1. Agile Wallaby. Macropus agilis. 1, 2, 3, 4, 5, 6, 12. Eastern Grey Kangaroo. ... http://rainforest-australia.com/agile_wallaby.htm ! Agile Wallaby ! Tropical Rainforest, North Queensland, Australia: ...stripe that runs along the cheek below a darker line from the eye, however, it is not as pronounced as it is on the 'Pretty Face Wallaby, Macropus parryi. ... http://www.nmnh.si.edu/msw/mammals_checklist.txt Monotremata Tachyglossidae Tachyglossus Tachyglossus aculeatus ...: Macropus dorsalis Macropus eugenii Macropus fuliginosus Macropus giganteus Macropus greyi Macropus irma Macropus parma Macropus parryi Macropus robustus ... http://www.australianstamp.com/Coin-web/feature/natufeat.htm Nature Features: EAGLE, Aquila audax; WHIPTAIL WALLABY, Macropus parryi; WHITE COCKATOO or Sulphur Crested Cockatoo,Cacatua galerita. Y: YELLOW-EYED ... http://www.bluep.com/~oco/Mammals2000.txt LAWRIE'S LIFE LIST OF AUSTRALIAN MAMMALS 27/9/2000 Platypus ...: Grey Kangaroo Macropus fuliginosus Eastern Grey Kangaroo Macropus giganteus Parma Wallaby Macropus parma Whiptail Wallaby Macropus parryi Common Wallaroo ... http://biology.unm.edu/biology/coccidia/marsup.html Coccidia of the World: Macropus thetis) (Red-necked pademelon); Reference: Johnson 1910a. Coccidian 2 of Johnson, 1910: Host: Macropus parryi (Whiptail wallaby); Reference: Johnson 1910a. ... http://www.ecopix.net/wildlife/wildlife.htm Ecopix.net environmental stock library - Wildlife (mammals): It formerly ranged to western Victoria.c96.3s, Pretty-faced Wallaby or Whiptail Macropus parryi lives in eastern Australia, one of several common, attractive ... http://www.ecopix.net/keyword/keywordM-R.htm keyword index for ecopix, MR: Macropus giganteus s18.5s, portrait s94s. Macropus parryi CQ8e. Macropus rufa s11.4s,s29.13s, (old) s7.1s, see also Megaleia rufa. Macrozamia douglasii f16s. ... http://www.davewattsphoto.com/specieslist/specieslist.htm Dave Watts Species List: Macropus fuliginosus. Whiptail Wallaby. Macropus parryi. Yellow-footed Rock Wallaby *. Petrogale xanthopus. To return to top of the page, click here. Home Page. ... http://www.geocities.com/ozwildlife/wallaby.html Australian Wildlife - Pretty-face and Parma Wallabies: Australian Wildlife - Pretty-face and Parma Wallabies. Pretty-face Wallaby (Macropus parryi). The Pretty-face Wallaby is also known as the Whiptail Wallaby. ... http://www.nhm.org/research/mammals/holdings/DIPROTOD.HTM Mammal Collection Holdings - Order DIPROTODONTIA: 2 Macropus agilis 2 Macropus dorsalis Queensland 2 Macropus fuliginosus New South Wales 2 Macropus giganteus 2 Macropus parma 1 Macropus parryi 2 Macropus ... http://members.fortunecity.fr/kangourou/liste.htm Fiches de tous les kangourous: ...- ... 5. Wallaby agile (macropus agilis). 2. Kangourou antilope (macropus antilopinus). 4. Wallaby de Parry (macropus parryi). 4. Wallaby à raie noir (macropus dorsalis). 4. ... http://www.goodzoos.com/Marsupial.htm Monotremes and Marsupials: Macropus irma. Western brush wallaby. Macropus parma. Parma wallaby. Australia. Macropus parryi. Whiptail wallaby. Macropus robustus. Wallaroo. Macropus rufogriseus. ... http://cyberwallaby.chez.tiscali.fr/famil_kangou.htm famil_kangou: ...- ... Protege dans tous les etats,mais chasse lorsqu'il cause des degats aux cultures. Wallaby de parry Macropus parryi. Taille:....environ 60 cm. ... http://www.deh.gov.au/biodiversity/trade-use/wild-harvest/kangaroo/harvesting/roobg_t1.html Overview of background information for kangaroo management - Table ...: ...clearing, foxes. Macropus parryi, Whiptail Wallaby, Common, Yes, Yes (Qld), Local eruptions, Grazer, benefited from grassland increase. Macropus ... http://www.deh.gov.au/biodiversity/trade-use/wild-harvest/kangaroo/harvesting/roobg_t2.html Overview of background information for kangaroo management - Table ...: Macropus robustus robustus, 33.6 + or - 1.3, 32.7 + or - .5, yes, yes, 15+, 30.9 + or - 2.0, a) - b)260 + or - 5.4, 8-9. Macropus parryi, 42.2, 36.3, no, ? ... http://www.australianmammals.org.au/species.htm Australian Mammal Species Files: Parma Wallaby (Kawau Is). Macropus parma. Whiptail Wallaby. Macropus parryi. Wallaroo. Macropus robustus. Common Wallaroo (central). Macropus robustus erubescens. ... http://www.joseflebovicgallery.com/Catalogue/Archive/Cat-84-2000/Pages/05.html Kangaroos: ...$190. 35 After Dickes. Macropus Derbianus [and] Macropus Parryi, c.1840s. Two engravings, by Lizars, hand-coloured, each 10 x 15cm approx. ... http://stockshot.faunafilm.com/dutch/stockshots/shotslatin.htm stockshots latijn: ...- ... macacus syvian macaca silenus, macropus agilis, macropus antilopinus, macropus bernardus, macropus giganteus, macropus parryi, macropus robustus, macropus rufus ... http://stockshot.faunafilm.com/english/stockshots/shotslatin.htm stockshots latijn: ...- ... macaca silenus, macropus agilis, macropus antilopinus, macropus bernardus, macropus giganteus, macropus parryi, macropus robustus, macropus rufus, macrotis ... http://www.users.sbg.ac.at/~zebra/d6e_systematik_hauptframe.htm Systematikliste-hf: 2. 1. -. -. Macropus giganteus. 81. 48. -. -. Macropus parma. 32. 16. 2. -. Macropus parryi. 39. 24. -. -. Macropus robustus. 32. 20. 1. -. Macropus robustus cervinus. 2. 1. -. -. ... http://home.t-online.de/home/irle.eifel/australia_mammals.html Irles Artenlisten - Australien - Säugetiere: Macropodidae, Macropus parma, Waterhouse,1846, Parma Wallaby. Macropodidae, Macropus parryi, Bennett,1835, Whiptail Wallaby. Macropodidae, ... http://www.deli-ostrich.com/prod_map_kangaroo.htm Welcome to Deli Ostrich: Eastern Grey kangaroo (Macropus giganteus) - Wallaroo, Euro or Hill kangaroo (Macropus robustus) - Whiptail Wallaby (Macropus parryi). ... http://www.noahsark.org.au/?act=wildlife&file=macropodsinfo Noah's Ark - Macropods Info: Whiptail Wallaby. Macropus parryi Macropus parryi (pa'-ree-ee: "Parry's long-foot", after E. Parry, explorer, who brought a live animal to England). ... http://www.earthfoot.org/places/au009b.htm Mammals around Cairns: 5, Agile Wallaby, Macropus agilis. 6, Whiptail Wallaby, Macropus parryi. 7, Northern Swamp Wallaby, Wallabia bicolor. 8, Northern Nailtail Wallaby, Onychogalea unguifera. ... http://www.bioproject.info/PARTICULAR_BIOLOGY/Superkingdom_Eukaryotae/Kingdom_Animalia/Phylum_Chordata/Subphylim_Vertebrata/Class_mammals/Subclass_Marsupials.html Subclass Marsupials : Class mammals : Subphylim Vertebrata ...: ...scientific order Marsupialia. The Virginia opossum is classified as Didelphis virginiana and the whiptail wallaby as Macropus parryi. ... http://svc018.wic010p.server-web.com/oxley/02_facts/03_vegetation_info.htm Oxley Vegetation & Habitats: Water dragon (Physignathus leseurii) Bearded dragon (Pogona barbata) Animals with a restricted distribution Whiptail wallaby (Macropus parryi) Yellow-bellied ... http://www.koala.net/ed/animals/roo4.htm Fact Sheet Temp.: Common Name, Scientific Name. Whiptail Wallaby, Macropus parryi. Introduction, Often called the Pretty-faced Wallaby because of its facial ... http://www.savci.upol.cz/dvojitoz.htm Diprotodontia Dvojitozubci: ...(syn. Wallabia parma) Macropus parryi Bennett, 1835 - klokan Paryův - Whiptail or Pretty-faced Wallaby Macropus robustus Gould, 1841 - klokan horský (syn. ... http://wallabies.mountcrosby.com/types.php Welcome to Mount Crosby: ...including grasses and shrubs. Whiptail or Pretty-faced Wallabies (Macropus parryi) have also been sighted. They are slender and ... http://www.furry.org.au/kangaroos/breeding/male-genitalia.html Male Genitalia: ...common among kangaroos. 1. Erect penis of a Pretty Face Wallaby (Macropus parryi). The scrotum of the Eastern Grey Kangaroo. In common ... http://www.museum.vic.gov.au/bioinformatics/mammals/images/Osp_par2.htm Museum Victoria [ed-online] Bioinformatics - Victorian Mammal ...: Australian Mammal Gould Print Images John Gould print image of the Whiptail Wallaby Macropus parryi (formerly known as Osphranter parryi). ... http://marspial.hp.infoseek.co.jp/kag2.htm カンガル―2: ...whiptail(pretty-face,Parry's)wallaby. (ï¼acropus.parryi). 分 布:ヨ-ク岬ã?‹ã‚‰ãƒ‹ãƒ¥ï¼?サウスウェ-ルズ州北æ?± 部. ... http://www.wildlife-australia.de/web/wallaby.htm wildlife-australia.de: ...- Hübschgesichtwallaby/Pretty-face Wallaby (Macropus parryi). Länge: Schwanz: Gewicht: 750 - 920 mm 780 - 940 mm 11 - 16 kg. Verbreitung ... http://encyclopedie.sytes.net/encyclopedia.php?title=Kangourou eBabylone.com: Encyclopédie - Kangourou: ...- ... agilis); Wallaby de Parry (macropus parryi); Wallaby à raie noir (macropus dorsalis); Wallaby de Benett (macropus rufogriseus); Wallaby ... http://www.featherdale.com.au/featherdale/featherdale.ns4/Animals/Whiptail+Wallaby Featherdale Wildlife Park - About Featherdale - Whiptail Wallaby: Scientific name: Macropus parryi Size: Up to 90cm Status: Common Diet: Grazer, feeding mainly on grasses and other forest plants including ferns. ... http://encarta.msn.com/text_761576076___2/Marsupial.html MSN Encarta - Print Preview - Marsupial: ...order Marsupialia. The Virginia opossum is classified as Didelphis virginiana and the whiptail wallaby as Macropus parryi. "Marsupial ... http://encarta.msn.com/encyclopedia_761576076/Marsupial.html MSN Encarta - Marsupial: Marsupialia. The Virginia opossum is classified as Didelphis virginiana and the whiptail wallaby as Macropus parryi. Further Reading. ... http://genstyle.imed.jussieu.fr/chaosgame/affichage_esp_list.php?lettres=m Alphabetical List of Species: ...- ... Macropus eugenii (18). Macropus fuliginosus (4). Macropus giganteus (13). Macropus parryi (1). Macropus robustus robustus (19). Macropus rufogriseus (9). ... http://people.hws.edu/mitchell/oz/VetFarm96.html Hobart & William Smith Queensland Term: UQ Vet Farm: ...(Photo taken at Lamington National Park.). Class: Mammalia Subclass: Theria Infraclass: Methatheria Species: Macropus parryi? "Whiptail ... http://search.looksmart.com/p/browse/us1/us317914/us146762/us217721/us226678/us217732/us330982/?&sn=10&se=16 LookSmart - Wallabies: Whiptail Wallaby Information on Macropus parryi, also called the Pretty-faced Wallaby, with notes on its diet, breeding and habitat. ... http://www.liveatcanon.it/doit_portfolio.asp?portfolio=WWF&page=13 Live@Canon: ...- Torna alla home page di Live@canon. Eventi, incontri , concorsi: tutto quello che fa di Canon il brand dell'immagine. Un nuovo modo ... http://www.liveatcanon.it/doit_dettaglio.asp?imgid=880&portfolio=WWF Live@Canon: ...- ... scorri le categorie. Titolo: Piccolo di canguro (Macropus parryi) nel marsupio WWF-Canon/Martin HARVEY Categoria: animali - mammiferi. registrati a live@canon, ... http://www.ahs.cqu.edu.au/ahsfaculty/biolenv/staff/lesley_warner2.htm Prof Lesley Warner: Labiomultiplex) uncinatus (Nematoda:Cloacinidae), with a description of a new species, L. contiguus, from Macropus parryi (Marsupialia:Macropodidae). ... http://www.nor.com.au/environment/clarencecatchment/mammals.htm mammals: Whiptail Wallaby (Macropus parryi). Habitat: Coast and ranges in undulating or hilly country with open forest and grass understorey. ... http://www.geometry.net/basic_m/marsupials_general.php Geometry.Net - Basic_M: Marsupials General: Marsupials: Mammals Analytical Chemistry. Classified links of the Chemistry Biology Information Center of ETH Zürich. (Macropus parryi) Text. ... http://www.geometry.net/detail/basic_m/marsupials_general.html Geometry.Net - Basic_M: Marsupials General: 5. Marsupials: Mammals Analytical Chemistry. Classified links of the Chemistry Biology Information Center of ETH Zürich. (Macropus parryi) Text. ... http://www.spohr-wildlife.ch/fotokatalog/script/fo_categories_e.php3?CatID=8&pg=16&Category= English name: Erinaceus europaeus. Westigel. Whiptail Wallaby. Macropus parryi. Hübschgesichtwallaby. White nosed Saki. Chiropotes albinasa. Weissnasensaki. White Whale. ... http://www.spohr-wildlife.ch/fotokatalog/script/fo_categories.php3?CatID=8&pg=6&Category= Deutscher Name: ...- Deutscher Name. Wissenschaftlicher Name. Englischer Name. Hübschgesichtwallaby. Macropus parryi. Whiptail Wallaby. dem Bestellkatalog zufügen, Indischer Elefant. ... http://www.speciesaccounts.org/Mammals.htm Mammals: Macropus rufogriseus (red-necked wallaby). Macropus eugenii (tammar wallaby). Macropus parryi (whiptail wallaby). Macropus giganteus (eastern gray kangaroo). ... http://www.schools.ash.org.au/bilbydiscussion/_disc1/00000038.htm Re: Bibly classification: ...kangaroo), Macropus giganteus (grey kangaroo), Macropus robustus (wallaroo or Euro), Macropus rufogriseus (red-necked wallaby), Macropus parryi (pretty-faced ... http://www.goop.org/~rpc/project_z/ PROJECT Z - Strolls in the Bush: Swamp Wallaby, Wallabia bicolor, Sep 1998. Western Grey Kangaroo, Macropus fulginosus, Nov 2002. Whiptail Wallaby, Macropus parryi, May 1999. ... http://listserv.arizona.edu/cgi-bin/wa?A2=ind0303d&L=birdchat&F=&S=&P=3631 BIRDCHAT archives -- March 2003, week 4 (#36): Also, one correction so far (thanks Bill Moorhead): the "Pretty-faced" Wallabies I saw at O'Reillys are actually Whiptail Wallabies, Macropus parryi. ... http://bighost.area.ba.cnr.it/srs6bin/wgetz?%5Btaxonomy-ParentId:9312%5D+-e TAXONOMY:9313 ID : 9313 PARENT ID : 9312 RANK : species GC ID : 1 ...: NAME : eastern gray kangaroo // TAXONOMY:9318 ID : 9318 PARENT ID : 9312 RANK : species GC ID : 1 MGC ID : 2 SCIENTIFIC NAME : Macropus parryi PREFERRED COMMON ... http://www.mail-archive.com/interlang@listbot.com/msg00552.html Faune australienne ang/fr: ...- ... red-necked pademelon (wallaby) = Thylogale thetis. Whiptail ou Pretty-faced Wallabies = Macropus parryi. Red-necked Wallabies = Macropus rufogriseus. ... http://www.usask.ca/biology/chilton/publications.htm chilton_publication_list: Labiomultiplex) uncinatus (Nematoda: Cloacinidae), with the description of a new species, L. contiguus, from Macropus parryi (Marsupialia: Macropodidae). ... http://www.nrm.se/ncc/mammalia.txt D1940302-ULC @MAMMALIA "SYSTEMATIC NUMBER","VALIDATION MARKER" ...: 1","E"," ",MACR PAMD1","Macropus parma","",NCC940302" "898070455503","1","E"," ",MACR PAYD1","Macropus parryi","",NCC940302" "898070456003","1 ... http://sege.ntu.edu.sg/cgi-bin/extract_info.pl?dbase=gbmam&field=exon&pop=139&type=1 Your Search Results: S}NADLCYGALAAIPGLQPVRPSGAMYLM{V}GIEMEHF PEFENDVEFTERLVAEQSVHCLPAT{C}FEYPNFFRVVITVPKVMMLEACSRIQEFCELHYHCAEGSQEECDK > 54283_AF187533 Macropus parryi protamine P1 ... http://sege.ntu.edu.sg/cgi-bin/extract_info.pl?dbase=gbmam&field=protein&pop=60&type=1 Your Search Results: 1017) , product("glycogen phosphorylase") RGMPGREEDXG{C}DPVSCPMIPQSFHESRVSSRLCSGQASQLFPITAEWLPRG{L}PPGILTTA > 54283_AF187533 Macropus parryi protamine P1 gene ... http://www.mujweb.cz/Veda/traxler/senplac.htm superordo : SENPLACENTULOJ - Metatheria (Aplacentalia) - vaÄ?natci: ...specio : makropo vipvosta - Macropus parryi (Wallabia canguru) (2 subspecioj) specio : makropo roka - Macropus robustus - klokan horskÅ. ... http://www.wjaeger.de/aus/ae-3.htm Animals English 3: Whiptail Wallaby. A striking chocolate brown face contrasting with a white chest gives this macropod its other name, pretty - faced wallaby [Macropus parryi]. ... http://wingsbirds.com/birdlists/australia00.htm Wings Birding Tours... Australia 2000 Birdlist: Red-necked Pademelon, 3, 25, N, Thylogale thetis. Whiptail (Prettyface) Wallaby, 1, 3, N, Macropus parryi. Agile Wallaby, 6, 20, N, Macropus agilis. ... http://www.blackwell-synergy.com/links/doi/10.1111/j.1365-294X.2004.02193.x/abs/ Assessment of prey overlap between a native (Polistes humilis) and ...: These were two Gallus gallus (chicken, 1100 and 1108); one Macropus giganteus (kangaroo) or Macropus parryi (wallaby, both 926); and one Teleogryllus oceanicus ... http://www.interaktv.com/mammals/Marsup.html Biologybase: Mammals of the World: Monotremes and Marsupials: Macropus giganteus. Macropus greyi. Macropus irma. Macropus parma. Macropus parryi. Macropus robustus. Macropus rufogriseus. Macropus rufus. Onychogalea fraenata. ... http://www.naturalvisions.co.uk/cgi-bin/nvsite/nv.pl?dct=y&l=m&tags_here [an error occurred while processing this directive] Macropus parryi [an error occurred while processing this directive] 40564 Whiptail Wallaby Whiptail Wallaby Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |