|
|
Malacothrix typica - Gerbil MouseIUCN Status: Lower Risk/Least ConcernIUCN Species Profile http://www.press.jhu.edu/books/walkers_mammals_of_the_world/rodentia/images/image.rodentia.muridae.malacothrix.html Thumbnails Page, Rodentia Muridae Malacothrix: Rodentia Muridae Malacothrix (Click on thumbnail to view larger image). Long-eared mouse, or gerbil mouse (Malacothrix typica), photo by John Visser. ... http://www.chez.com/rodent/Muridae/Muridae.html Muridae: Leporillus conditor - Stick-nest rat - Australia - Sturt. Genus Malacothrix. Malacothrix typica - Gerbil mouse ; Long-eared mouse -. Genus Myospalax. ... http://www.interaktv.com/mammals/Rodentia2myo.html Biologybase: Mammals of the World: Rodentia 2 (Myomorpha): Dendroprionomys rousseloti. Deomys ferrugineus. Leimacomys buettneri. Malacothrix typica. Megadendromus nikolausi. Prionomys batesi. Steatomys caurinus. ... http://animaldiversity.ummz.umich.edu/site/accounts/classification/Dendromurinae.html ADW: Dendromurinae: Classification: Malacothrix (gerbil mouse). Species Malacothrix typica (gerbil mouse). Genus Megadendromus (Nikolaus's mouse). Species Megadendromus ... http://www.nasmus.co.za/MAMMALS/COLLECTI.HTM collection: Lepus saxatilis. Lemniscomys rosalia. Loxodonta africana. Top. Malacothrix typica. Manis temminckii. Miniopterus schreibersii. Mus minutoides. Mus musculus. ... http://www.nfi.org.za/mammals/species%20list.html Transvaal Museum - Mammal Department: Cricetomys, gambianus, Gaint rat. Saccostomus, campestris, Pouched mouse. Malacothrix, typica, Large-eared mouse. Dendromus, nyikae, Nyika climbing mouse. ... http://www.fmnh.helsinki.fi/users/haaramo/Metazoa/Deuterostoma/Chordata/Synapsida/Eutheria/Rodentia/Myomorpha/Dendromurinae.htm Muridae: Dendromurinae: ...| |-- S. jacksoni ()? | | S. krebsii ()? | | S. parvus (kääpiörasvahiiri) | `-- S. pratensis (rasvahiiri) |-- Malacothrix typica ()? ... http://www.wildlifehunt.co.za/articles/december2003.html Game & Hunt - advertise, auctions, game, hunting, independent ...: Occasionally I have also found the pygmy mouse (Mus minutoides) and big-eared mouse (Malacothrix typica) inhabiting or seeking refuge in old termite mounds. ... http://www.io.com/~hmiller/furry/MizarianMice.html Mizarian Mice: The Eki (Malacothrix eki, left of center) have distinctly reddish fur, and large ears resembling those of the long-eared mouse (Malacothrix typica) of southern ... http://perso.club-internet.fr/boudetjo/ZooList/Mammif/ClasRode.html Classification des Rodentiens: ...nyikae Dendromus oreas Dendromus vernayi Dendroprionomys rousseloti Deomys ferrugineus Leimacomys buettneri Malacothrix typica Megadendromus nikolausi ... http://www.rodent.be/rodentnederlands/Taxonomie/muridae.htm Muridae: Deomys ferrugineus. Leimacomys. Leimacomys buettneri. Malacothrix. Malacothrix typica. Megadendromus. Megadendromus nikolausi. Prionomys. Prionomys batesi. Steatomys. ... http://www.phthiraptera.org/Mammals/Muridae.html Mammals: Muridae: Mouse Malacothrix. Malacothrix typica (A. Smith, 1834) - Gerbil Mouse Hoplopleura biseriata Ferris, 1921 *. Megadendromus. Megadendromus ... http://www.visitsouthafrica.com/National_Parks/Golden_Gate_Highlands_np.asp VisitSouthAfrica.com - National Parks - Golden Gate Highlands ...: Dendromus mystacalis, LESSER CLIMBING MOUSE. Malacothrix typica, LARGE-EARED MOUSE. Mystromus albicaudatu, WHITE-TAILED RAT (VULNERABLE). ... http://www.savci.upol.cz/hlod-2.htm Rodentia - Hlodavci: Leimacomys buettneri Matschie, 1893 - myš xx - Groove-toothed Forest Mouse. Malacothrix typica (A. Smith, 1834) - myš xx - Gerbil Mouse. ... http://www.emporia.edu/biosci/msl/rodent.htm MSL, Order Rodentia: Med. & Vet. Sci., Adelaide, 1972. H J Aslin Malacothrix typica - Gerbil mouse; Long-eared mouse - S Africa; 91 Side view, Victoria West, South Africa, 1974. ... http://www.und.ac.za/und/cogen/asmn/asmn2.html ASMN- page 2: LAGOMORHA: Pronolagus crassicaudatus RODENTIA: Dendromus nyikae, Otomys laminatus, Georychus capensis, Malacothrix typica, Otomys sloggetti. ... http://www.saparks.com/SouthAfrica/GoldenGate/goldengate_main.htm Golden Gate National park - South Africa: GRASS CLIMBING MOUSE. Dendromus mystacalis. LESSER CLIMBING MOUSE. Malacothrix typica. LARGE-EARED MOUSE. Mystromus albicaudatu. WHITE-TAILED RAT (VULNERABLE). ... http://lgsun.grc.nia.nih.gov/cgi-bin/pro21?sname=J0072F07-3 Top Hits of J0072F07-3: Top Hits of J0072F07-3, NCBI 'nt' Database Hits 16-AUG-00 ... http://lgsun.grc.nia.nih.gov/cgi-bin/pro21?sname=J0215B11-3 Top Hits of J0215B11-3: Top Hits of J0215B11-3, NCBI 'nt' Database Hits 07-SEP-00 ... http://nema.cap.ed.ac.uk/nematodeESTs/Ascaris/Ascaris300-324/Asmc-319xnr.html National Center for Biotechnology Information (NCBI) welcome to ...: P+ LE+ L F+SW Sbjct: 169 GLKTDAIPGRLNQATLVSSRPGLFYGQCSEICGANHSFMPIVLEMVPLKQFESW 222 pir||I49438 cytochrome c oxidase II - Malacothrix typica mitochondrion >gi ... http://www.micro-genomes.mpg.de/cgi-bin/getblast.cgi?pir030305.orfprot.RB4417.blastp getblast.pl beck@molgen-mpg.de: ...cytochrome c oxi... 77 3e-13 SP_TREMBL:Q37547 Q37547 malacothrix typica (long-eared mouse). c... 77 3e-13 SP_TREMBL:Q8PFT5 Q8pft5 xanthomonas axonopodis (pv. ... http://industry.ebi.ac.uk/~alan/BioWidget/Taxonomy/tax4.data 1 root 1 2759 Eukaryotae 1 42452 unclassified eukaryotes 2759 ...: 10066 10084 Cricetomys 40142 10085 Cricetomys gambianus 10084 40143 Dendromurinae 10066 37437 Malacothrix 40143 37438 Malacothrix typica 37437 39107 Murinae ... http://www.esapubs.org/archive/ecol/E084/094/MOMv3.3.txt AF extant Artiodactyla Bovidae Addax nasomaculatus 4.85 70000.3 60 ...: ...- ... Muridae Malacomys edwardsi 1.84 69.9 60 AF extant Rodentia Muridae Malacomys longipes 1.98 95.6 135 AF extant Rodentia Muridae Malacothrix typica 1.13 13.4 60 ... http://www.parks-sa.co.za/parks/TankwaKaroo/default.html Tankwa Karoo National Park: Cape hare. W. Lepus saxatilis. Scrub Hare. R. Malacothrix typica. Large-eared mouse. Mellivora capensis. Ratel (Honey badger). R. Mus domesticus. House mouse. C. ... http://bioinfo.hku.hk/db/cutg/gbrod.spsum Acomys cahirinus: 2 1 12 8 4 1 4 2 7 11 3 1 6 3 12 2 3 13 2 5 16 2 ...: 0 13 7 0 4 1 0 10 10 0 4 16 3 0 3 9 10 0 4 18 6 2 0 10 5 1 2 10 0 10 5 6 0 8 4 6 0 10 2 9 7 3 0 17 12 9 28 18 1 1 1 0 10 Mitochondrion Malacothrix typica: 1 3 ... http://www.esi.umontreal.ca/~bourdeav/HH/DB_HH/HTML/HH-I-13/HH-I-13.rod.sol.filN.html HH-I-3: 60 nuc ..|CU|C|GGG| --- MTU18834 Malacothrix typica cytochrome c oxidase II gene, mitochondrial gene --- (684 bases) ---- complementary sequence ... http://www.infobiogen.fr/db/cutg/CUTG/gbrod.spsum Abrothrix jelskii: 1 0 2 1 0 1 0 1 1 4 2 1 1 1 7 0 4 6 0 1 5 0 2 2 ...: 0 13 7 0 4 1 0 10 10 0 4 16 3 0 3 9 10 0 4 18 6 2 0 10 5 1 2 10 0 10 5 6 0 8 4 6 0 10 2 9 7 3 0 17 12 9 28 18 1 1 1 0 10 mitochondrion Malacothrix typica: 1 3 ... http://www.es.embnet.org/srsbin/cgi-bin/wgetz?-id+01M28Zr+%5Bpir-AccNumber:I49438%5D+-e [an error occurred while processing this directive] Malacothrix typica [an error occurred while processing this directive] 12712 Gerbil Mouse Gerbil Mouse Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |