|
|
Mus cookii - Cook's MouseIUCN Status: Lower Risk/Least ConcernIUCN Species Profile http://animaldiversity.ummz.umich.edu/site/accounts/information/Mus.html ADW: Mus: Classification: Species Mus cervicolor (fawn-colored mouse). Species Mus cookii (Cook's mouse). Species Mus crociduroides (Sumatran shrewlike mouse). ... http://merops.sanger.ac.uk/speccards/peptidase/sp001928.htm Peptidase of Mus cookii (Cook's mouse): Mus cookii (Cook's mouse). TAXONOMY. Taxonomy database identifier: 10098. Superkingdom, Eukaryota. Kingdom, Animalia. Subkingdom, Metazoa. Phylum, Chordata. ... http://merops.sanger.ac.uk/famcards/lbl/s8b_lbl.htm Family alignment - key to sequences: ...by MEROPS) (-) (residues: 178-468) 54 S08.031 (Onchocerca volvulus) blisterase (Q7Z0F0) (residues: 177-468) 55 S08.072 (Mus cookii) proprotein convertase 1 ... http://imgt.cines.fr/textes/IMGTrepertoire/LocusGenes/tabgenes/mouse/IGK/IGKC/Mu_IGKC.html IMGT Marie-Paule page: IMGT repertoire: Gene and allele table: Mouse (Mus musculus, Mus saxicola, Mus pahari, Mus minutoides, Mus cookii, Mus spretus) IGKC ... Mouse (Mus cookii) IGKC ... http://imgt.cines.fr/textes/IMGTrepertoire/Proteins/alleles/mouse/IGK/IGKC/Mu_IGKCoverview.html IMGT Marie-Paule page: IMGT repertoire: Alignment of alleles: Mouse (Mus musculus, Mus saxicola, Mus pahari, Mus minutoides, Mus cookii, Mus spretus) IGKC (overview) Only ... http://www.il-st-acad-sci.org/mammals/murids002.html MURINAE: Subgenus Mus. Mus booduga. Ricefield mouse, Mus caroli. Fawn-coloured mouse, Mus cervicolor. Cook's mouse, Mus cookii. Dunn's mouse, Mus dunni. House mouse, Mus musculus. ... http://www.bio.sk/dir/?cat=0&area=0&tax=10088 BIO.SK - Directory: MUS>. Mus abbotti (0). Mus booduga (0). Mus caroli (0). Mus cervicolor (0). Mus cookii (0). Mus crociduroides (0). Mus dunni (0). Mus famulus ... http://www.knowledgebank.irri.org/IPM/key4id/The_genus_Mus_(the_true_mice).htm The genus Mus (the true mice): ...in most). Mus cookii. A moderately large (head+body to 96 mm) mouse with large eyes and relatively small ears (to 15 mm). The tail ... http://www.knowledgebank.irri.org/IPM/key4id/Key_to_agricultural_rodent_pests_of_southeast_Asia.htm Key to agricultural rodent pests of southeast Asia: 8. 3a. Fur stiff, very spiny. Mus cookii. 3b. Fur soft, lacking obvious spines. 4. 4a. Tail almost as long or longer than head + body. 5. 4b. ... http://www.signaling-gateway.org/molecule/query?afcsid=A000047&type=extrecords&adv=latest Database links for AfCS protein A000047 - Signaling Gateway: 1994, Mus sp. GenBank, 474274, AAC04933.1, -, angiotensin II type-2 receptor [Mus cookii], 363, 1, 5 Mar 1998, Mus cookii. SwissProt, 543779, ... http://bioinfo.hku.hk/db/imgt/IMGT/relnotes.html IMGT/LIGM relnotes: Escherichia coli 2 9147 Lepus americanus 2 1018 Macaca arctoides 2 90 Macaca cyclopis 2 415 Marmota monax 2 1189 Mesocricetus auratus 2 5282 Mus cookii 2 2901 ... http://www3.oup.co.uk/nar/database/summary/503 IMGT/GENE-DB: ...and 2,201 alleles (673 IG and TR genes and 1,024 alleles from Homo sapiens, and 702 IG and TR genes and 1,177 alleles from Mus musculus, Mus cookii, Mus pahari ... http://www.educ.ls.toyaku.ac.jp/~s007081/dna.html dna: LOCUS MUSTAUT 2558 bp mRNA linear ROD 12-MAY-1997 DEFINITION Mus cookii taurine/beta-alanine transporter mRNA, complete cds. ... SOURCE Mus cookii. ... http://www.educ.ls.toyaku.ac.jp/~s017037/last2 last2: ...ggagggacct ccgcgtgaga atcaaatacc tgataacccc cagggagccc aaccgctggg ctgtggagcg tgaaggggcc acaccctttc actcccgagt aaccctcatg ＜é?ºä¼?å?＞ Mus cookii taurine/beta ... http://getentry.ddbj.nig.ac.jp/cgi-bin/get_entry.pl?U00766 Get Entry: Your query was: U00766 LOCUS U00766 2871 bp mRNA linear ROD 05-MAR-1998 DEFINITION Mus cookii Balb/c angiotensin II type-2 receptor (AT2) mRNA, complete cds. ... http://getentry.ddbj.nig.ac.jp/cgi-bin/get_entry.pl?D31942 Get Entry: ...linear ROD 07-FEB-1999 DEFINITION Mouse mRNA for mouse oncostatin M. ACCESSION D31942 VERSION D31942.1 KEYWORDS oncostatin M. SOURCE Mus cookii ORGANISM Mus ... http://www.es.embnet.org/Doc/ECJ/ECJ-1998-03/imgt.html IMGT: Macaca nemestrina, 6, 2295. Mesocricetus auratus, 2, 5282. Monodelphis domestica, 40, 14153. Mus cookii, 2, 2901. Mus domesticus, 91, 30838. Mus minutoides, 1, 1624. ... http://www.es.embnet.org/srsbin/cgi-bin/wgetz?-id+01M28Zr+%5Bpir-AccNumber:A55631%5D+-e Entry Page: Note, in Genbank entry MUSRLK, release 116.0, the source is designated as Mus cookii. Features. Key, Description, Location, Length. Domain, SH3 homology, 89 - 137, 49. ... http://www.unep-wcmc.org/igcmc/rl_anml/mammals.html Mammals checklist for India: Leopoldamys edwardsi Meriones hurrianae Micromys minutus Millardia gleadowi Millardia kondana Millardia meltada Mus booduga Mus cervicolor Mus cookii Mus dunni ... http://www.itis.usda.gov/servlet/SingleRpt/SingleRpt?search_topic=TSN&search_value=180365 ITIS Standard Report Page: Mus: Species, Mus caroli Bonhote, 1902, Species, Mus cervicolor Hodgson, 1845, Species, Mus cookii Ryley, 1914, Species, Mus crociduroides (Robinson and Kloss, 1916), ... http://www.itis.usda.gov/servlet/SingleRpt/RefRpt?search_type=expert&search_id=expert_id&search_id_value=57 ITIS 'Expert(s)' Search results for Guy G. Musser: Mus caroli Bonhote, 1902 -- valid. Mus cervicolor Hodgson, 1845 -- valid. Mus cookii Ryley, 1914 -- valid. Mus crociduroides (Robinson and Kloss, 1916) -- valid. ... http://www.ebi.ac.uk/parasites/EGN/BLASTS/BLAST-AI676621.html BLAST data for AI676621: 124, 0.91, 2. emb|U22437|MC22437, Mus cookii steroid receptor mRNA, p... 129, 0.96, 1. emb|L14611|HSRZRA, Human transcription factor RZR-alph... 129, 0.96, 1. ... http://redpoll.pharmacy.ualberta.ca/RefDB/corrdata/bmr5242.str.corr data_5242 #NB (Observed* = Observed shift + Offset correction) ...: 1 "(M58589) convertase 1 [Mus musculus]" 11.95% 753 100% 100% 2e-42 GenBank AAA39896.1 "(M58507) propeptide processing protease [Mus cookii]" 11.95% 753 100 ... http://www.jbc.org/cgi/content/abstract/266/19/12715 JBC -- Abstracts: Reue and Leete 266 (19): 12715: ...had four repeat units, as found in C57BL/6. Among wild-derived mice, however, one species (Mus spretus) had three repeats, two species (Mus cookii and Mus ... http://www.nih.go.jp/yoken/genebank/MNCb/seq5/MNCb-1126.BLA BLASTN 2.0a2MP-WashU [20-Oct-1996] [Build 22:58:53 Oct 20 1996] ...: 762 1.3e-27 1 gb|L32178|ROD MUSGATGABA Mus cookii GABA transporter (... ... 515 2.0e-16 1 gb|L03292|ROD MUSTAUT Mus cookii taurine/beta-alanine ... ... http://www.nih.go.jp/yoken/genebank/MNCb/seq5/MNCb-4074.BLA BLASTN 2.0a2MP-WashU [20-Oct-1996] [Build 22:58:53 Oct 20 1996] ...: 1492 4.3e-71 2 emb|AJ003024|MAM OCHNRNPK Oryctolagus cuniculus mRNA for ... 1456 6.0e-70 2 gb|L31961|ROD MUSPHOSPHO Mus cookii phosphoprotein mRN... ... http://www.ta-lon.com/trips/IUCN_6.htm à¸à¸±à¸™à¸”ับ: X, -, X, -. 293, à¸à¸±à¸™à¸”ับสัตว์ฟันà¹?ทะ, หนูหริ่งใหà¸?่, -, Mus cookii, X, X, -, X, -. 294, ... http://meropslinks.iapc.bbsrc.ac.uk/MeropsLinks/Speccards/sp001928.htm Peptidases of Mus cookii (Cook's mouse): Mus cookii (Cook's mouse). Page created 21-Mar-2001. TAXONOMY. Taxonomy database identifier: 10098. Superkingdom, Eukaryota. Kingdom, Animalia. Subkingdom, Metazoa. ... http://meropslinks.iapc.bbsrc.ac.uk/MeropsLinks/lbl/S08B_lbl.htm Subfamily S8B alignment - key to sequences: 44 S08.072 (Sus scrofa) proprotein convertase 1 (Q28959) 45 S08.072 (Bos taurus) proprotein convertase 1 (-) 46 S08.072 (Mus cookii) proprotein convertase 1 ... http://www.genmapp.org/MAPPSet-Mouse/GenMAPP.org_MAPPs/Gene_Family_MAPPs/_Support/Mm_Peptide_GPCRs/AT2_P35374.htm AT2 Backpage: ...complete cds. ID: U00766 Definition: Mus cookii Balb/c angiotensin II type-2 receptor (AT2) mRNA, complete cds. ID: L32840 Definition ... http://geta.life.uiuc.edu/RDP/data/SubMito/Mito_alpha.M.html SSU Mitochondrial rRNA Alphabetic List -- "M": Chinese muntjac; barking deer) -- mitochondrion [1173]····4.4.6.3.6·····Mus_cook_M·····Mus cookii (Cook's mouse ... http://www.icb.ufmg.br/~lgb/schisto/categories/k.htm Transcription: ...for HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN K Putative gene for HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN K (HNRNP K) Similar to Mus cookii HETEROGENEOUS NUCLEAR ... http://www.icb.ufmg.br/~lgb/schisto/inf/list.htm List of identified uniques: ...repair protein RAD23 homolog A Contig475 - Similar to Drosophila melanogaster CG7510 gene product Contig476 - Similar to Mus cookii Heterogeneous nuclear ... http://www.receptors.org/NR/seq/DR/Q60570.TABDR.html NucleaRDB Cross References for Q60570: Description, Steroid receptor (Fragment). Gene, RORA. Organism, Mus cookii (Cook's mouse). Chromosomal location, -. Gene Ontology, QuickGO. IUPHAR receptor code, -. ... http://www.receptors.org/NR/seq/all/Q60570.SW.html Swiss-Prot entry: 01, Last sequence update) DT 01-MAR-2004 (TrEMBLrel. 26, Last annotation update) DE Steroid receptor (Fragment). GN RORA. OS Mus cookii (Cook's mouse). ... http://seq.molgen.mpg.de/hgs/S171_RIGHT.table_swplus.html Results of BLAST-searches against: swplus: 00879, 114373, 114534, +1, 398, 451, mus cookii. heterogeneous nuclear ribonucleoprotein k (hnrnp k) (phosphoprotein). 5/1999 Length = 464. ..... ... http://presage.berkeley.edu/search.cgi?spac=Q60570 PRESAGE : Search results: SWISS-PROT: Q60570 Q60570. Other IDs: pacc: AAA91122.1. Species: Mus cookii. Description: Rar-related orphan receptor alpha (steroid receptor) (fragment). ... http://bioinformatics.weizmann.ac.il/databases/embl/align/ds35643.dat Title: Mammalian mitochondrial 12S rRNA sequences AUTHOR: Marc W. ...: ...(unpub.) auratus Rodentia Muridae Microtus X99464; Dubois et al. (unpub.) nivalus Rodentia Muridae Mus cookii X85946; Sourouille et al. ... http://bodymap.ims.u-tokyo.ac.jp/mouse/ms_gs_card.php?gs=GS06033 BODYMAP - GS Card - MOUSE: ...[MOUSE] GS Card. GS06033. Definition. Mus cookii phosphoprotein mRNA, complete cds. #ACC. L31961. #UniGene. Mm.21953. Representative sequence. ... http://bodymap.ims.u-tokyo.ac.jp/mouse/ms_gs_card.php?gs=GS02784 BODYMAP - GS Card - MOUSE: ...[MOUSE] GS Card. GS02784. Definition. Mus cookii taurine and beta-alanine transporter mRNA, complete cds. #ACC. L03292. #UniGene. Mm.25834. Representative sequence. ... http://www.infobiogen.fr/db/embl-align/ds38659.dat TITLE: Alignment of 12S rRNA sequences from 118 mammalian taxa ...: MAU Mesocricetus auratus X84390 MNI Microtus nivalus X99464 MMU Mus musculus J01420 MSE Mus setulosus X85949 MMA Mus mattheyi X85950 MCO Mus cookii X85946 MCR ... http://www.infobiogen.fr/srs71bin/cgi-bin/wgetz?-id+4xSu61MINBk+%5Bsptrembl-ID:Q8WA43%5D+-e Entry Page: Transport; Mitochondrion;. Description, cytochrome b. Gene name(s), cytb. Organism source, Mus cookii (Cook's mouse). Organism classification, ... http://www.allgenes.org/allgenes/servlet?page=rna&id=DT.100781908&view=nrdb allgenes.org | DoTS Transcript DT.100781908: ...view, AAO21805.1, 8.7e-21, +, Y-linked zinc finger protein 2 [Mus cookii]. view, AAO21829.1, 8.7e-21, +, autosomal zinc finger protein [Mus cookii]. ... http://www.nap.edu/books/0309063329/html/193.html Nat'l Academies Press, Infectious Diseases of Mice and Rats (1991) ...: Hosts. Mus musculus (laboratory and wild). Similar viruses have been reported in other species, including Mus cervicolor, Mus cookii. ... http://www.nap.edu/books/0309063329/html/167.html Nat'l Academies Press, Infectious Diseases of Mice and Rats (1991) ...: Some wild mouse species, including Mus caroli, Mus cookii, and Mus cervicolor popaeus, are highly susceptible to experimental infection. ... http://perso.club-internet.fr/boudetjo/ZooList/Mammif/ClasRode.html Classification des Rodentiens: Millardia kondana Millardia meltada Muriculus imberbis Mus baoulei Mus booduga Mus bufo Mus callewaerti Mus caroli Mus cervicolor Mus cookii Mus crociduroides ... http://www.psb.ugent.be/rRNA/ssu/list/Mitochondria.html ssu rRNA Mitochondria: Mus saxicola X85948; Mit. Mustela vison Y08514; Mit. Mus setulosus X85949; Mit. Mus cookii X85946; Mit. Mus crociduroides X85951; Mit. Mus mattheyi X85950; Mit. ... http://sgce.cbse.uab.edu/cgi-bin/text_blast_server.py?PW=11058-F12&DB=nr F36F12.8: AAO21845.1, 28, 98, 2.00e-06, 41, 136, 107, 203, X-linked zinc finger protein [Mus cookii]gb|AAO21846.1| X-linked zinc finger protein [Mus caroli]. ... http://sgce.cbse.uab.edu/sgce/Blastnr/p11058/11058-F12.blastnr BLASTP 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas ...: ...product [Mus musculus] 55 2e-06 dbj|BAB21766.2| KIAA1675 protein [Homo sapiens] 55 2e-06 gb|AAO21845.1| X-linked zinc finger protein [Mus cookii] >gi|308... ... http://exon.bic.nus.edu.sg/~meena/sege/gb130/gbrod2.output 1_AL589738 DEFINITION Mouse DNA sequence from clone RP23-322J11 on ...: 40_AY057813 DEFINITION Mus cookii cytochrome b (Cytb) gene, complete cds; mitochondrial gene for mitochondrial product. ORGANISM ... http://microarray.caltech.edu/pubs/ctx-pnas/clusters%5Ccluster11.txt Cluster ID Gene 0d 1d 2d 3d 5d 10d 14d 11 H3136A12-3 "ATPase, H+ ...: 11 H3099C09-3 Mouse mRNA for preproinsulin-like growth factor IA 0 -0.255123 2.351993 2.256476 1.997583 0.934361 0.482573 11 H3125F10-3 Mus cookii 129/SV ... http://microarray.caltech.edu/pubs/ctx-pnas/clusters%5Ccluster12.txt Cluster ID Gene 0d 1d 2d 3d 5d 10d 14d 12 ZX00002E22 ADP ...: 0.010573 12 H3134H10-3 Murine mRNA for integrin beta subunit 0 0.965877 1.305993 0.876476 1.447583 0.124361 0.652573 12 H3049H09-3 "Mus cookii taurine/beta ... http://www.savci.upol.cz/hlod-3.htm Rodentia - Hlodavci: Callewaert's Mouse Mus caroli Bonhote, 1902 - myÅ¡ - Ryukyu Mouse Mus cervicolor Hodgson, 1845 - myÅ¡ plavohnÄ›dá - Fawn-colored Mouse Mus cookii Ryley, 1914 ... http://www.cs.ubc.ca/~jslack/tj/mammalia_A_03-04-16.nh (((((('platypus')'ornithorhynchus')'ornithorhynchidae' ...: ...muriculus imberbis')'muriculus',('mus baoulei','mus booduga','mus bufo','mus callewaerti','mus caroli','mus cervicolor','mus cookii','mus crociduroides','mus ... http://www.kazusa.or.jp/codon/M.html Alphabetical list: M: Valley encephalitis virus [gbvrl]: 1 Mus caroli [gbrod]: 35 Mus cervicolor [gbrod]: 1 Mus cervicolor popaeus endogenous virus [gbvrl]: 1 Mus cookii [gbrod]: 9 ... http://clapton.biobase.dk/srs6bin/cgi-bin/wgetz?-id+2Jsvr1L4H0O+%5Btaxonomy-ParentId:10088%5D+-e Entry Page: COMMON NAME : fawn-colored mouse // TAXONOMY:10098 ID : 10098 PARENT ID : 10088 RANK : species GC ID : 1 MGC ID : 2 SCIENTIFIC NAME : Mus cookii GENBANK COMMON ... http://www.dsi.univ-paris5.fr/genatlas/fiche1.php?symbol=LAD1 Genatlas sheet: STRUCTURE. motifs/domains. HOMOLOGY. interspecies. homolog to Mus cookii ladinin 1. homolog to C.elegans F55F8.4. intraspecies. FAMILY. CATEGORY, structural protein. ... http://www.chickest.udel.edu/orthohuman/h101.html BLAST Search Results: 175 5e-42 gb|U00768.1|U00768 Mus cookii 129/SV angiotensin II type-2 ... 175 5e-42 gb|L32840.1|MUSAIR Mus musculus angiotensin II receptor mRN... ... http://www.chickest.udel.edu/orthomouse/m484.html BLAST Search Results: 486 e-135 gb|AF141930.1|AF141930 Trichoplusia ni high affinity GABA t... 486 e-135 gb|L32178.1|MUSGATGABA Mus cookii GABA transporter (GAT-1) ... 485 e-135 dbj ... http://www.esi.umontreal.ca/~bourdeav/HH/DB_HH/HTML/HH-III-5/HH-III-5.rod.sol.filN.html HH-I-3: GAA|AGC| |SCO: 0.61|POS:918-973|MIS: 0|WOB: 1| |GCU|U|CCC|G|GGG|CCAAGGA|GGG|GAUCCUCUUCUACAUCACACCCAACU|UCC|GAA|AGC| --- MUSGATGABA Mus cookii GABA transporter ... http://www.esi.umontreal.ca/~bourdeav/HH/DB_HH/HTML/HH-I-5/HH-I-5.rod.sol.filN.html HH-I-3: UCC|GAA|AG|.. 96 nuc ..|CU|U|UCC| --- MUSGATGABA Mus cookii GABA transporter (GAT-1) mRNA, complete cds. --- (2042 bases) |SCO: 1.06 ... http://val.cbi.pku.edu.cn/srs7bin/cgi-bin/wgetz?-id+4loob1L3C9W+%5Bprints-AccNumber:PR00176%5D+-e Entry Page: RATTUS NORVEGICUS (RAT). tt; NTG1_MUSCO SODIUM- AND CHLORIDE-DEPENDENT GABA TRANSPORTER 1 - MUS COOKII. tt; NTG1_RAT SODIUM- AND ... http://val.cbi.pku.edu.cn/srs7bin/cgi-bin/wgetz?-id+4xSu_1L1vQp+%5Blibs_EQ_%7Bswissprot_SP_trembl%7D-ID:NEC1_MOUSE%5D+-e Entry Page: ...processing protease). GN PCSK1 OR NEC1 OR NEC-1 OR ATT-1. OS Mus musculus (Mouse), and OS Mus cookii (Cook's mouse). OC Eukaryota ... http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Link&db=Protein&dbFrom=Protein&from_uid=26352027 Entrez-Protein: ...angiotensin II type-2 receptor [Mus cookii] gi|474274|gb|AAC04933.1|[474274] ... http://xenopus.nibb.ac.jp/cgi-bin/getBlastTax?entname=rXL179o18%7C21&outfile=clone BLAST results: Heterogeneous nuclear ribonucleoprotein K (hnRNP K) (65 kDa phosphoprotein).>prf:2017296A kappa-B motif-binding phosphoprotein - Mus cookii>gp:MUSPHOSPHO_1 ... http://www.changbioscience.com/primo/ti.html Primo: Murine rotavirus (13), Mus caroli (10). Mus cookii (8), Mus musculus (1244). Mus musculus domesticus (28), Mus musculus musculus (6). Mus pahari (13), Mus sp. (236). ... http://144.16.65.194/hpg/envis/doc1999ahtml/biodmamal200414.html Mammals of India: Mus booduga (Gray) -- LRlc 162. Mus cervicolor Hodgson -- LRlc 163. Mus cookii (Ryley) -- LRnt 164. Mus musculus (Linnaeus) -- LRlc 165. ... http://www.cse.ucsc.edu/research/compbio/yeast-protein-predictions/Q010/Q0105/Q0105.t2k.pa.html a2m2html output for file tmp.a2m: ...obscurus]. gi|18446766|gb|AAL23823.1|_2:377 cytochrome b [Mus cookii]. gi|1256163|dbj|BAA12252.1|_2:377 cytochrome b [Capra falconeri]. ... http://eyesite.cryst.bbk.ac.uk/family77/ SODIUM NEUROTRANSMITTER SYMPORTER FAMILY (SNF): ...sp|P31642|S6A6_MUSCO Sodium and chloridedependent taurine and betaalanine transportergi|2078449|gb|AAB54039.1| L03292 taurinebetaalanine transporter [Mus cookii ... http://www.hgmp.mrc.ac.uk/Research/Antisense/reverse-refseq/NM_0/NM_009212.results.html Reverse sense database: D2, complete sequence. 65 _ EM:AF220633 AF220633 (repeat region: l1-like element) Mus cookii clone site112, genomic sequence. 65 _ ... http://www.hgmp.mrc.ac.uk/Research/Antisense/reverse-refseq/NM_0/NM_011077.results.html Reverse sense database: ...complete sequence. 107 __ EM:AF220633 AF220633 (repeat region: l1-like element) Mus cookii clone site112, genomic sequence. 105 ... http://www.genetics.wustl.edu/fish_lab/frank/cgi-bin/fish/search.cgi?p=fb50c08 WUZGR - EST Project Home: 304 3.6e-26 1;; gi|473912 (L31961) phosphoprotein [Mus cookii] 304 3.6e-26 1;; pir||S41224 hnRNP protein - African clawed frog ... ... http://cancerres.aacrjournals.org/cgi/content/abstract/41/4/1451 Cancer Research -- Abstracts: Colcher et al. 41 (4): 1451: Monoclonal antibodies have been generated against disrupted mammary tumor viruses isolated from Mus musculus, Mus cervicolor, and Mus cookii. ... http://genome.jgi-psf.org/cgi-bin/dispGeneModel.v4?db=Chr19ncbi34&id=33638 Protein Pages: Chr19ncbi34: ...genome.jgi-psf.org/cgi-bin/dispGeneModel. v4?db=Chr19ncbi34&id=33638 - 18k - Cached - Similar pages Protein Pages: Chr19ncbi34genome.jgi-psf.org/cgi-bin/dispGeneModel. v4?db=Chr19ncbi34&id=26791 - 18k - Cached - Similar pages[ More results from genome.jgi-psf.org ] [PDF] eview of the major pest speciesFile Format: PDF/Adobe Acrobat - View as HTML ... 142 Mus cervicolor ? – + + + 144 Mus cookii – + + + ? 146 Mus ... http://genome.jgi-psf.org/cgi-bin/dispGeneModel.v4?db=Chr19ncbi34&id=26791 Protein Pages: Chr19ncbi34: ...genome.jgi-psf.org/cgi-bin/dispGeneModel. v4?db=Chr19ncbi34&id=26791 - 18k - Cached - Similar pages[ More results from genome.jgi-psf.org ] [PDF] eview of the major pest speciesFile Format: PDF/Adobe Acrobat - View as HTML ... 142 Mus cervicolor ? – + + + 144 Mus cookii – + + + ? 146 Mus ... http://www.phthiraptera.org/Mammals/Muridae.html Mammals: Muridae: Hoplopleura johnsonae Kim, 1966 *. Mus cookii Ryley, 1914 - Cook´s Mouse; Mus crociduroides (Robinson and Kloss, 1916) - Sumatran Shrewlike Mouse; ... http://www.cx.unibe.ch/dkf3/PI_D1_frizzled/FZD1_blastp.html BLAST Search Results: 46 0.001 gi|841240 (U19600) alpha 1 type XVIII collagen [Mus cookii] 46 0.001 gi|1167906 (U03715) alpha-1(XVIII) collagen [Mus musculus] 46 0.001 sp|P13773 ... http://genome.jouy.inra.fr/db/gcg/sptrembl/sptr_mhc_000.seq Q95I82 6/2003 ASCII Len: 70 Q95i82 stizostedion vitreum. major ...: 6/2003 GCELTQEGRKRGYSQFAYDGKDYLSLDKETLTWTASDGRAHVTKRRRDADRVWTEGRRNFVEGRC >>>>O02877 6/2003 ASCII Len: 90 O02877 mus cookii (cook's mouse). ... http://aac.asm.org/cgi/content/full/43/10/2576 AAC -- Labia; and Ishii 43 (10): 2576: Two 17-base identities were obtained, respectively, for the Mus cookii DNA sequence, GenBank accession number M97512 (3'-tggtgacgtggctcaaa-5', starting at base ... http://jbpc.mbl.edu/Spraguea-HTML/14-23F.br.html BLASTX 2.0.8 [Jan-05-1999] Reference: Altschul, Stephen F., Thomas ...: ...rlk - mouse >gi|2117815|pir||I49133 Txk - mouse >gi|562125 (U16145) Txk [Mus musculus] >gi|623443 (L35268) resting lymphocyte kinase [Mus cookii] >gi|643065 ... http://mws1.bms.ed.ac.uk/public/cgi-bin/DB_hits.pl?tailname=28_T7.gcg_nr.blastx 28_T7.gcg_nr.blastx: Sbjct: 439 YGTMQTLTC 447 >sp|P48057|NTG1_MUSCO SODIUM- AND CHLORIDE-DEPENDENT GABA TRANSPORTER 1 >gi|533226 (L32178) GABA transporter [Mus cookii] Length = 598 ... http://bioinf.wehi.edu.au/folders/matt/HHRvsNHR_old_results.txt bioinf.wehi.edu.au/folders/matt/HHRvsNHR_old_results.txt: BG080118;Mus musculus ubiquilin 1 (Ubqln1), mRNA" "11.7682662920021" "-0.000848593393075256" "-6.54836440490556" "2" "7" "26" "C81465;Mus cookii taurine/beta ... http://genearrays.uchsc.edu/docs/mousecdna15k.txt Clone_description GB# Unigene Homologene GeneCard LocusLink ...: ...prosome, macropain) 26S subunit," AA409615 Mm.21667 Mm.21667 "Homo sapiens cDNA: FLJ23442 fis, clone HSI00956" BG076565 Mm.155 Mm.155 "Mus cookii linear IgA ... http://rdp.cme.msu.edu/download/SSU_rRNA/SSU_Mito.alpha (July 31, 1998) MITOCHONDRIAL SMALL SUBUNIT rRNA: ALPHABETICALLY ...: 1435] Munt.rvs_M Muntiacus reevesi (Asian muntjac; Reeves's muntjac;Chinese muntjac; barking deer) -- mitochondrion [1173] Mus_cook_M Mus cookii (Cook's mouse ... http://srs.pku.edu.cn/srs7bin/cgi-bin/wgetz?-id+4xSuY1MS_tI+%5Bsptrembl-ID:Q60569%5D+-e Entry Page: TrEMBLrel. 24, Last annotation update) DE Alpha 1 type XVIII collagen precursor (Fragment). GN COL18A1. OS Mus cookii (Cook's mouse). OC ... http://www.azotobacter.org/AVA/BLASTX/M32371::AAA22173.1::NO_gene::nitrogenase.blx BLASTX 2.2.1 [Apr-13-2001] Reference: Altschul, Stephen F., Thomas ...: Q60577|ROK_MOUSE HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN K (HNRNP K) (65 KDA PHOSPHOPROTEIN) gb|AAA21731.1| (L31961) phosphoprotein [Mus cookii] Length = 464 ... http://lgsun.grc.nia.nih.gov/cgi-bin/pro21?sname=H3002A06-5 [an error occurred while processing this directive] Mus cookii [an error occurred while processing this directive] 13958 Cook's Mouse Cook's Mouse Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |