Mus platythrix - Flat-Haired Mouse

IUCN Status: Lower Risk/Least Concern
IUCN Species Profile
Peptidase of Mus platythrix (flat-haired mouse): Mus platythrix (flat-haired mouse). TAXONOMY. Taxonomy database identifier: 10101. Superkingdom, Eukaryota. Kingdom, Animalia. Subkingdom, Metazoa. Phylum, Chordata. ...
http://merops.sanger.ac.uk/pepcards/sequence/t01p013.htm

Peptidase sequence data for T01.013: 2r. AAA98932, U35323, U35323, AAA98932, Mus platythrix. MER06145, O35523, O35523, BAA22580, O35523, D44459, D44459, BAA22580, Mus spicilegus. MER05508, ...
http://www.il-st-acad-sci.org/mammals/murids002.html

MURINAE: Phillip's spiny mouse, Mus phillipsi. Brown spiny mouse, Mus platythrix. Indian spiny mouse, Mus saxicola. Indochina spiny mouse, Mus shortridgei. ...
http://animaldiversity.ummz.umich.edu/site/accounts/information/Mus.html

ADW: Mus: Classification: ...pahari (Gairdner's shrewmouse). Species Mus phillipsi (Phillips's mouse). Species Mus platythrix (flat-haired mouse). Species Mus saxicola ...
http://www.itis.usda.gov/servlet/SingleRpt/SingleRpt?search_topic=TSN&search_value=180365

ITIS Standard Report Page: Mus: Species, Mus pahari Thomas, 1916, Species, Mus phillipsi Wroughton, 1912, Species, Mus platythrix Bennett, 1832, Species, Mus saxicola Elliot, 1839, ...
http://www.itis.usda.gov/servlet/SingleRpt/RefRpt?search_type=expert&search_id=expert_id&search_id_value=57

ITIS 'Expert(s)' Search results for Guy G. Musser: Mus pahari Thomas, 1916 -- valid. Mus phillipsi Wroughton, 1912 -- valid. Mus platythrix Bennett, 1832 -- valid. Mus saxicola Elliot, 1839 -- valid. ...
http://www.bio.sk/dir/?cat=0&area=0&tax=10088

BIO.SK - Directory: Mus minutoides (0). Mus musculoides (0). Mus musculus (1). Mus pahari (0). Mus platythrix (0). Mus poschiavinus (0). Mus saxicola (0). Mus setulosus (0). Mus sp. ...
http://www.allgenes.org/allgenes/servlet?page=rna&id=DT.87036891&view=nrdb

allgenes.org | DoTS Transcript DT.87036891: ...macedonicus]. view, AAO62982.1, 4.1e-41, +, Fxy protein [Arvicola terrestris]. view, AAO53222.1, 6.1e-40, +, Fxy [Mus platythrix]. view, AAP69949 ...
http://www.unep-wcmc.org/igcmc/rl_anml/mammals.html

Mammals checklist for India: ...kondana Millardia meltada Mus booduga Mus cervicolor Mus cookii Mus dunni Mus famulus Mus musculus Mus pahari Mus phillipsi Mus platythrix Mus saxicola Nesokia ...
http://www.unep-wcmc.org/igcmc/rl_anml/indvert.html

Endemic Animals of India: Alticola roylei Apodemus rusiges Cremnomys cutchicus Cremnomys elvira Millardia kondana Mus famulus Mus phillipsi Mus platythrix Platacanthomys lasiurus Rattus ...
http://www.resourceshimalaya.org/fauna/mammalsnew.htm

FAUNA...MAMMALS OF NEPAL: 82. Bandicota bengalensis. 83. Mus musculus. 84. Mus cervicolor. 85. Mus platythrix. 86. Rattus nitidus. 87. Rattus rattus. 88. Rattus sikkimensis. 89. ...
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&list_uids=4661448&dopt=Citation

The reaction of Mus platythrix to Kyasanur Forest Disease Virus.: The reaction of Mus platythrix to Kyasanur Forest Disease Virus. Goverdhan MK, Anderson CR. MeSH Terms: Animals; Antibodies, Viral; ...
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&list_uids=2638383&dopt=Citation

Chigger mite infestation of small mammals in a feral biotope of a ...: Chiggers were absent on Mus platythrix from a habitat about 40 meters away from the B. bengalensis and S. murinus collection sites. ...
http://www.dli.gov.in/data0/001/670/HTM/00000201.htm

0000 - 0201.htm: 6, Number 2, June 1984, pp. 193-202. Printed in India. Adrenocorticotrophin secreting cells in the hypophysis of the brown spiny mouse Mus platythrix (Bennett). ...
http://www.dli.gov.in/data0/001/670/TXT/00000201.txt

J. Biosci., Vol. 6, Number 2, June 1984, pp. 193-202. Printed in ...: Adrenocorticotrophin secreting cells in the hypophysis of the brown spiny mouse Mus platythrix (Bennett) NH GOPAL DUTT and NA MADHYASTHA* Department of Post ...
https://www.vedamsbooks.com/no29903.htm

Endemic Mammals of India/JRB Alfred and S. Chakraborty: 40. Mus famulus Bonhote. 41. Mus phillipsi Wroughton. 42. Mus platythrix (Bennett). 43. Apodemus rusiges Miller. 44. Platacanthomys lasiurus Blyth. Discussion. ...
http://reo.nii.ac.jp/journal/HtmlIndicate/html/vol_issues/SUP0000001000/JOU0001000095/ISS0000000733/article_list.html

NII-REO Volume9 , Issue1: We constructed the comparative cytogenetic maps of X chromosomes in three rodent species, Indian spiny mouse (Mus platythrix), Syrian hamster and Chinese ...
http://ces.iisc.ernet.in/hpg/kartik/res5.htm

WILL THE MEEK INHERIT THE EARTH?: Western Ghats. The Indian Field mouse (Mus booduga) and the spiny Field Mouse (Mus platythrix) are found in most habitats. The Indian ...
http://geta.life.uiuc.edu/RDP/data/SubMito/Mito_alpha.M.html

SSU Mitochondrial rRNA Alphabetic List -- "M": ...pahari (Gairdner's shrew mouse) -- mitochondrion [1169]····4.4.6.3.6·····Mus_plat_M·····Mus platythrix (flat-haired ...
http://bioc09.uthscsa.edu/~hs_lab/frames/abstract.html

Abstracts - SC Hardies: From these data we conclude that members of the L1 family are evolving in concert at the DNA sequence level in Mus domesticus, Mus caroli, and Mus platythrix. ...
http://content.karger.com/ProdukteDB/produkte.asp?Aktion=ShowAbstract&ProduktNr=224037&Ausgabe=226739&ArtikelNr=56852

Karger Publishers: ...and subsequently comparing, introns of the Y-chromosomal tspy genes from Apodemus agrarius, A. sylvaticus, A. flavicollis, Mus platythrix (subgenus Pyromys), M ...
http://www.ingenta.com/isis/browsing/TOC/ingenta?issue=pubinfobike://klu/chro/2003/00000011/00000001

Ingenta: Table of Contents -- Chromosome Research, January 2003 ...: 6. Identification of chromosome rearrangements between the laboratory mouse (Mus musculus) and the Indian spiny mouse (Mus platythrix) by comparative FISH ...
http://meropslinks.iapc.bbsrc.ac.uk/meropslinks/lbl/T01A_lbl.htm

Subfamily T1A alignment - key to sequences: Mus spicilegus) proteasome catalytic subunit 1i (-) 23 T01.013 (Mus dunni) proteasome catalytic subunit 1i (-) 24 T01.013 (Mus platythrix) proteasome catalytic ...
http://meropslinks.iapc.bbsrc.ac.uk/meropslinks/Sequence/PT01p013.htm

Peptidase sequence data for code T01.013: U22919, U22919, halotype H-2b. U22920, U22920, halotype H-2r. AAA98932, U35323, U35323, AAA98932, Mus platythrix. O35523, BAA22580, D44459, D44459, BAA22580, Mus spicilegus. ...
http://bioinformatics.weizmann.ac.il/databases/embl/align/ds35643.dat

Title: Mammalian mitochondrial 12S rRNA sequences AUTHOR: Marc W. ...: ...(1981) Rodentia Muridae Mus pahari X84383; Hanni et al. (unpub.) Rodentia Muridae Mus platythrix X85947; Sourrouille et al. (unpub ...
http://www.dekker.com/servlet/product/DOI/101081CBI120005389/section/section1_2

CIRCADIAN PHASE AND PERIOD RESPONSES TO LIGHT STIMULI IN TWO ...: ...booduga. The phase shifts were found to be positively correlated with the period changes (r=+0.45, p<0.0001; n=130). Mus platythrix. The ...
http://www.dekker.com/servlet/product/DOI/101081CBI120005389/section/default

CIRCADIAN PHASE AND PERIOD RESPONSES TO LIGHT STIMULI IN TWO ...: 2002. Abstract. We report period response curves (τRC) for two nocturnal Murid species from India, Mus booduga and Mus platythrix. ...
http://www.infobiogen.fr/db/embl-align/ds38659.dat

TITLE: Alignment of 12S rRNA sequences from 118 mammalian taxa ...: X85949 MMA Mus mattheyi X85950 MCO Mus cookii X85946 MCR Mus crociduroides X85951 MPA Mus pahari X84383 MSA Mus saxicola X85948 MPL Mus platythrix X85947 MAV ...
http://www.infobiogen.fr/db/index-gcg/sptrembl/sptr_mhc.seqcat

O00157 O00157 homo sapiens (human). leukocyte antigen (fragment). ...: ...macedonian mouse). mhc class ii (fragment). 6/2003 90aa O02909 O02909 mus platythrix (flat-haired mouse). mhc class ii (fragment). 6 ...
http://perso.club-internet.fr/boudetjo/ZooList/Mammif/ClasRode.html

Classification des Rodentiens: Mus mattheyi Mus mayori Mus minutoides Mus musculoides Mus musculus Mus neavei Mus orangiae Mus oubanguii Mus pahari Mus phillipsi Mus platythrix Mus saxicola ...
http://www.psb.ugent.be/rRNA/ssu/list/Mitochondria.html

ssu rRNA Mitochondria: Mus musculus J01420; Mit. Mus musculus V00711; Mit. Mus platythrix X85947; Mit. Mustela nivalis Y08515; Mit. Myoictis wallacei AF009887; Mit. ...
http://www.ranwa.org/punealive/pamam.htm

Pune Alive - Retreating wild mammals of Pune Urban Area: A. Fringes. Mus musculus. Common house-rat. H. C. Wadas, Grainary. Mus platythrix. Indian brown spine-mouse. A. Fringes. Bandicota bengalensis. Indian mole-rat. A. ...
http://www.savci.upol.cz/hlod-3.htm

Rodentia - Hlodavci: Mouse Mus pahari Thomas, 1916 - myš - Gairdner's Shrewmouse Mus phillipsi Wroughton, 1912 - myš Phillipsova - Phillips's Mouse Mus platythrix Bennett, 1832 ...
http://clapton.biobase.dk/srs6bin/cgi-bin/wgetz?-id+2Jsvr1L4H0O+%5Btaxonomy-ParentId:10088%5D+-e

Entry Page: SYNONYM : Mus spretoides // TAXONOMY:10101 ID : 10101 PARENT ID : 10088 RANK : species GC ID : 1 MGC ID : 2 SCIENTIFIC NAME : Mus platythrix GENBANK COMMON ...
http://www.cs.ubc.ca/~jslack/tj/mammalia_A_03-04-16.nh

(((((('platypus')'ornithorhynchus')'ornithorhynchidae' ...: ...mayori','mus minutoides','mus musculoides','house mouse','mus neavei','mus orangiae','mus oubanguii','mus pahari','mus phillipsi','mus platythrix','mus saxicola ...
http://www.kazusa.or.jp/codon/M.html

Alphabetical list: M: 102 Mus musculus molossinus [gbrod]: 6 Mus musculus musculus [gbrod]: 29 Mus musculus wagneri [gbrod]: 2 Mus pahari [gbrod]: 18 Mus platythrix [gbrod]: 2 Mus ...
http://144.16.65.194/hpg/envis/doc1999ahtml/biodmamal200414.html

Mammals of India: 31. Mus phillipsi (Wroughton) -- LRlc 32. Mus platythrix Bennett -- LRlc 33. Otomops wroughtoni (Thomas) -- CR -- (B1, 2c) 34. Ovis ...
http://medsfgh.ucsf.edu/id/CpTags/blastx1299/CpGR0221A.blast2x_b.html

Running RepeatMasker: 160 to_Entrez to_Related to_Related >gi|2467357|dbj|BAA22580| (D44459) low molecular mass polypeptide complex subunit 2 [Mus platythrix] Length = 219 Frame 2 ...
http://medsfgh.ucsf.edu/id/CpTags/blastx1299/CpGR0221B.blast2x_b.html

Running RepeatMasker: 214 to_Entrez to_Related to_Related >gi|2467357|dbj|BAA22580| (D44459) low molecular mass polypeptide complex subunit 2 [Mus platythrix] Length = 219 Frame -2 ...
http://sgce.cbse.uab.edu/cgi-bin/text_blast_server.py?PW=11-D3&DB=nr

C27B7.1: O19110, 29, 204, 2.00e-15, 25, 219, 117, 317, TSPY_BOVIN Testis-specific Y-encoded protein (bTSPY). AAF63962.1, 27, 187, 4.00e-15, 28, 212, 146, 332, TSPY [Mus platythrix]. ...
http://sgce.cbse.uab.edu/sgce/Blastnr/p011/11-D3.blastnr

BLASTP 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas ...: ...testis-specific protein [Bos taurus] 85 2e-15 sp|O19110|TSPY_BOVIN Testis-specific Y-encoded protein (bTSPY) 85 2e-15 gb|AAF63962.1| TSPY [Mus platythrix] 84 4e ...
http://xenopus.nibb.ac.jp/cgi-bin/getCloneBlast?XL008p14

Clone XL008p14 [sequences]: Homo sapiens]. gi|912878|gnl|db|gp:AF205114_1, 54, 50, 9e-06, 39-218, 269-328, +3, 334, [AF205114] gi:7576730 TSPY [Mus platythrix]. gi|640915 ...
http://xenopus.nibb.ac.jp/cgi-bin/getCloneBlast?XL016g23

Clone XL016g23 [sequences]: Specific Prote. gi|912878|gnl|db|gp:AF205114_1, 65, 68, 1e-10, 398-664, 144-232, +2, 334, [AF205114] gi:7576730 TSPY [Mus platythrix]. gi|690891 ...
http://hair-loss-stop.com/ref-hair/hair-research-abs4.310.html

Successful topical treatment of murine cutaneous leishmaniasis ...: ...indica was recorded. In southern India, the overall prevalence of the 8 species of mites was highest on Mus platythrix. However, the ...
http://genome.jgi-psf.org/cgi-bin/dispGeneModel.v4?db=whiterot1&id=67643

Protein Pages: Phanerochaete chrysosporium (White Rot fungus): ...genome.jgi-psf.org/cgi-bin/ dispGeneModel.v4?db=whiterot1&id=67643 - 24k - Cached - Similar pages Protein Pages: Chlamydomonas reinhardtii (Chlamy)genome.jgi-psf.org/cgi-bin/ dispGeneModel.v4?db=chlre2&tid=160468 - 22k - Cached - Similar pages[ More results from genome.jgi-psf.org ] BLAST Search Results ... 140 1e-32 gb|L05580.1|MUSPTX Mus platythrix beta-2 microglobulin gene 139 3e-32 gb|L05581.1|MUSCOK Mus cooki beta-2 microglobulin gene 139 6e-32 gb|AF191646.2 ...
http://genome.jgi-psf.org/cgi-bin/dispGeneModel.v4?db=chlre2&tid=160468

Protein Pages: Chlamydomonas reinhardtii (Chlamy): ...genome.jgi-psf.org/cgi-bin/ dispGeneModel.v4?db=chlre2&tid=160468 - 22k - Cached - Similar pages[ More results from genome.jgi-psf.org ] BLAST Search Results ... 140 1e-32 gb|L05580.1|MUSPTX Mus platythrix beta-2 microglobulin gene 139 3e-32 gb|L05581.1|MUSCOK Mus cooki beta-2 microglobulin gene 139 6e-32 gb|AF191646.2 ...
http://www.chickest.udel.edu/orthohuman/h25.html

BLAST Search Results: 140 1e-32 gb|L05580.1|MUSPTX Mus platythrix beta-2 microglobulin gene 139 3e-32 gb|L05581.1|MUSCOK Mus cooki beta-2 microglobulin gene 139 6e-32 gb|AF191646.2 ...
http://biodiversity.iucnp.org/MammalsOfPak.htm

Biodiversity Programme - IUCN Pakistan: Mouse; Mus cervicolor – Fawn-coloured Mouse (extra-limital); Mus platythrix – Indian Brown Spiny Mouse (extra-limital); Mus saxicola ...
http://www.phthiraptera.org/Mammals/Muridae.html

Mammals: Muridae: Hoplopleura pahari Johnson, 1972 *. Mus phillipsi Wroughton, 1912 - Phillip´s Mouse; Mus platythrix Bennett, 1832 - Flat-haired Mouse ...
http://www.jimmunol.org/cgi/content/full/169/12/6890

The JI -- Davis et al. 169 (12): 6890: Cell lines from Mus dunni, Mus abbotti, Mus setulosus, Mus minutoides, Mus platythrix, Mus shortridgei, and Mus pahari were obtained from Dr. S. Chattopadhyay ...
http://www.cse.ucsc.edu/research/compbio/yeast-protein-predictions/YKR0/YKR048C/YKR048C.t2k.pa.html

a2m2html output for file tmp.a2m: ...gi|21757167|dbj|BAC05043.1|_179:382 unnamed protein product [Homo sapiens]. gi|7576730|gb|AAF63962.1|AF205114_1_131:328 TSPY [Mus platythrix]. ...
http://industry.ebi.ac.uk/~alan/BioWidget/Taxonomy/tax4.data

1 root 1 2759 Eukaryotae 1 42452 unclassified eukaryotes 2759 ...: 10088 10096 Mus spretus 10088 10097 Mus cervicolor 10088 10098 Mus cookii 10088 10100 Mus macedonicus 10088 10101 Mus platythrix 10088 10102 Mus setulosus ...
http://rdp.cme.msu.edu/download/SSU_rRNA/SSU_Mito.alpha

(July 31, 1998) MITOCHONDRIAL SMALL SUBUNIT rRNA: ALPHABETICALLY ...: ...house mouse) -- mitochondrion <Mus_musc_M> [1171] Mus_paha_M Mus pahari (Gairdner's shrew mouse) -- mitochondrion [1169] Mus_plat_M Mus platythrix (flat-haired ...
http://cbr-rbc.nrc-cnrc.gc.ca/reith/salmon/spleen/SS1-0845.html

OUTPUT from blastx for SS1-0845: ...dbj|BAA22580.1| (D44459) low molecular mass polypeptide complex subunit 2 [Mus platythrix] Length = 219 Score = 210 bits (530), Expect = 7e-54 Identities = 100 ...
http://bighost.area.ba.cnr.it/srs6bin/wgetz?-id+4xSu71M7fvl+%5Btaxonomy-ParentId:10088%5D+-e

Entry Page: SYNONYM : Mus spretoides // TAXONOMY:10101 ID : 10101 PARENT ID : 10088 RANK : species GC ID : 1 MGC ID : 2 SCIENTIFIC NAME : Mus platythrix PREFERRED COMMON ...
http://www.icb.ufmg.br/~lgb/schisto/blastNT/Contig1038.htm

BLAST Search Results: 135 6e-29 gb|M77104.1|MUSMTDNAG Mus platythrix mitochondrion DNA frag... 135 6e-29 ref|NC_001992.1| Papio hamadryas mitochondrion, complete ge... ...
http://www.icb.ufmg.br/~lgb/schisto/blastNR/Contig233.htm

BLAST Search Results: ...bA392M18.1 (novel p... 119 5e-26 emb|CAA04709.1| (AJ001377) TSPY [Rattus norvegicus] 114 1e-24 gb|AAF63962.1|AF205114_1 (AF205114) TSPY [Mus platythrix] 113 2e ...
http://genoma.unsam.edu.ar/projects/tca/blast_dir/nr/tca-06o13.b1.br

BLASTX 2.1.3 [Apr-1-2001] Reference: Altschul, Stephen F., Thomas ...: I+ K Sbjct: 70 RAEAKLYYSQSGKRMSVKALATLLANIMNGAK 101 >dbj|BAA22580.1| (D44459) low molecular mass polypeptide complex subunit 2 [Mus platythrix] Length = 219 ...
http://bioinfo.hku.hk/db/cutg/gbrod.spsum

Acomys cahirinus: 2 1 12 8 4 1 4 2 7 11 3 1 6 3 12 2 3 13 2 5 16 2 ...: 25 35 57 14 30 28 34 24 19 16 90 24 40 27 58 22 21 10 32 66 25 24 106 47 36 22 77 26 26 20 70 51 36 38 26 27 43 31 37 12 65 19 50 10 3 6 3 Mus platythrix: 2 4 ...
http://www.knowledgelink.co.jp/i-mode/mammal/doc/m280.html

[an error occurred while processing this directive] Mus platythrix [an error occurred while processing this directive] 13978
Flat-Haired Mouse Flat-Haired Mouse

Home | Search | About


Copyright SpeciesList.com 2003-2009