|
|
Nannospalax ehrenbergi - Palestine Mole RatIUCN Status: Lower Risk/Least ConcernIUCN Species Profile http://www.dicle.edu.tr/~yukselc/spalax2.htm TÃœRKÄ°YE: 1. Nannospalax leucodon 2. Nannospalax nehringi 3. Nannospalax ehrenbergi 4. Spalax zemni 5. Spalax arenarius 6. Spalax graecus 7. Spalax microphtalmus 8 ... http://1kai.dokkyomed.ac.jp/mammal/en/species_all/nannospalax_ehrenbergi.html Nannospalax ehrenbergi: Nannospalax ehrenbergi Ehrenberg's Mole-rat Classification. Order: Rodentia (Rodents) Family: Muridae (Mice, Rats, Voles, Gerbils ... http://1kai.dokkyomed.ac.jp/mammal/jp/species_all/nannospalax_ehrenbergi.html Nannospalax ehrenbergi: Nannospalax ehrenbergi Ehrenberg's Mole-rat シリアヒメメク ラãƒ?ズミ 分類. 目：Rodentia（Rodents, ã?’ã?£æ¯ç›®ï¼‰ 科 ... http://animaldiversity.ummz.umich.edu/site/accounts/classification/Nannospalax_ehrenbergi.html ADW: Nannospalax ehrenbergi: Classification: Nannospalax ehrenbergi (Palestine mole rat). Specimens; Classification. What do these icons mean? ... Species Nannospalax ehrenbergi (Palestine mole rat). ... http://animaldiversity.ummz.umich.edu/site/accounts/specimens/Spalacinae.html ADW: Spalacinae: Classification: Specimens; Classification. Palestine mole rat Nannospalax ehrenbergi, Palestine mole rat Nannospalax ehrenbergi, Palestine mole rat Nannospalax ehrenbergi. ... http://www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=Nannospalax+ehrenbergi+%5Bgbrod%5D Codon usage table: Nannospalax ehrenbergi [gbrod]: 10 CDS's (2632 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU 15.2( 40) UCU ... http://www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=Nannospalax+ehrenbergi+carmeli+%5Bgbrod%5D Codon usage table: Nannospalax ehrenbergi carmeli [gbrod]: 1 CDS's (866 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU 30.0( 26 ... http://www.cbs.dtu.dk/courses/27013/data4.gb LOCUS SEH5819 1648 bp DNA linear ROD 29-MAR-1999 DEFINITION Spalax ...: SOURCE Nannospalax ehrenbergi (Ehrenberg's mole-rat) ORGANISM Nannospalax ehrenbergi Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia ... http://www.cbs.dtu.dk/services/GenomeAtlas/show-atcontent.php?segmentid=Nehrenbergi_Strain_mtDNA DNA Structural Analysis of Sequenced Microbial Genomes: AT content in Nannospalax ehrenbergi strain Strain. ... Genome Atlas AT content (for Nannospalax ehrenbergi) has been accessed 26 times since 2004-03-24 18:55:56. ... http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=Nucleotide&cmd=Search&term=CA8&doptcmdl=DocSum Entrez-Nucleotide: Nannospalax ehrenbergi microsatellite CA8.2 sequence gi|24637265|gb|AF438226.1|[24637265] ... http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=search&db=nucleotide&term=NC_005315&qty=1 Entrez Nucleotide: Nannospalax ehrenbergi mitochondrion, complete genome gi|40805109|ref|NC_005315.1|[40805109]. ... http://robetta.bakerlab.org/results.jsp?id=890&p=8 Robetta Structure Prediction Server Job 890 Results - aB full WT: AAA3... 30637, Nannospalax ehrenbergi, 2 (0.2%), 3E-39, 1-170, 1-170, 162, 97, 170, emb|CAC33095.1|, alphaB-crystallin [Nannospalax ehrenbergi]. ... http://robetta.bakerlab.org/results.jsp?id=889&p=8 Robetta Structure Prediction Server Job 889 Results - aB57 WT: ...h... 30637, Nannospalax ehrenbergi, 2 (0.2%), 3E-21, 1-100, 58-157, 101, 97, 100, emb|CAC33095.1|, alphaB-crystallin [Nannospalax ehrenbergi]. ... http://www.signaling-gateway.org/molecule/query?afcsid=A000155&type=blastrecord&adv=latest&idx=45 Blast record info for AfCS protein A000155 - Signaling Gateway: 5-hydroxytryptamine 1B receptor (5-HT-1B) (Serotonin receptor 1B) [Spalax leucodon ehrenbergi (Ehrenberg's mole rat)], 386, 15 Jun 2004, Nannospalax ehrenbergi. ... http://www.signaling-gateway.org/molecule/query?afcsid=A003389&type=blast&adv=latest Blast data for AfCS protein A003389 - Signaling Gateway: 3.84E-15, 86.6557, 24.29, 23.32, Clock protein [Nannospalax ehrenbergi carmeli ... http://www.chickest.udel.edu/orthochick/c186.html BLAST Search Results: 86 2e-21 emb|X89811.1|DMSSRP2GN D.melanogaster DNA for SSRP2 gene 86 2e-21 gb|AF078817.2|AF078817 Nannospalax ehrenbergi high mobility... ... http://www.chickest.udel.edu/orthomouse/m186.html BLAST Search Results: 74 3e-22 gb|AF078817.2|AF078817 Nannospalax ehrenbergi high mobility... 107 5e-22 gb|AF078820.2|AF078820 Nannospalax ehrenbergi high mobility... ... http://www.gwdg.de/service/info-all/gen-sequenz/db_metazoa_mito_link.html mitochondriale Gensequenzen (Metazoen): Myoxus glis. Myripristis berndti. Myxine glutinosa. Nannospalax ehrenbergi. Nansenia ardesiaca. Narceus annularus. Necator americanus. Neoceratodus forsteri. ... http://www.zrs-kp.si/Zaloznistvo/annales%20majora/mammals.HTM Annales Majora: Å¡estih vrst pa so pretežno znotraj meja TurÄ?ije (Talpa davidiana, Spermophilus xanthoprymnus, Mesocricetus brandti, Nannospalax ehrenbergi, Myomimus roachi ... http://mpc.uci.edu/hampson/public_html/blast/jf_no_rrna/nrResults/tac71c01.y1.html BLAST Search Results: ...done Score E Sequences producing significant alignments: (bits) Value *emb|CAC33095.1| alphaB-crystallin [Nannospalax ehrenbergi] 53 1e-06 *gb|AAP31996.1 ... http://mpc.uci.edu/hampson/public_html/blast/jf_no_rrna/nrResults/tab28d03.x1.html BLAST Search Results: ...unknown [Homo sapiens] 91 1e-17 *emb|CAA42911.1| alpha B-crystallin [Rattus rattus] 91 1e-17 *emb|CAC33095.1| alphaB-crystallin [Nannospalax ehrenbergi] 91 1e ... http://www.museum.hu-berlin.de/mitarb/mitarb_publ.asp?name=Manfred.Ade&lang=0&column=1 museum für naturkunde berlin: mitarbeiterinnen und mitarbeiter :: Ade, M. & Ziekur, I. (1999a): The Forepaws of the Rodents Cryptomys hottentotus (Bathyergidae) and Nannospalax ehrenbergi (Muridae, Spalacinae): Phylogenetic ... http://medsfgh.ucsf.edu/id/CpTags/blastx1299/E380.blast2x_b.html Running RepeatMasker: 307 AAYR GP Sbjct: 160 AAYRA-KGKP 168 to_Entrez to_Related to_Related >gi|3342573 (AF078818) high mobility group protein [Nannospalax ehrenbergi] Length = 215 ... http://medsfgh.ucsf.edu/id/CpTags/blastx1299/E158.blast2x_b.html Running RepeatMasker: 65 KADKLRYEKEMKNY 78 to_Entrez to_Related to_Related >gi|5764680|gb|AAC27653.2| (AF078820) high mobility group protein [Nannospalax ehrenbergi] Length = 215 ... http://www.bioone.org/bioone/?request=get-document&issn=0022-2372&volume=084&issue=01&page=0185 BULLAR VOLUME IN SUBTERRANEAN AND SURFACE-DWELLING CAVIOMORPH ...: ...with sensitive hearing at low frequencies have cochlear specializations but lack enlarged bullae; eg, subterranean blind (Nannospalax ehrenbergi) and naked ... http://www.bioone.org/bioone/?request=get-document&issn=0022-2372&volume=084&issue=01&page=0272 DAILY MOVEMENTS AND MAXIMUM SPEED IN <GENSP>CTENOMYS TALARUM ...: ...is notably shorter than distances moved in natural burrows by other fossorial rodents (T. bottae, 574 m/day—Gettinger 1984 ; Nannospalax ehrenbergi, 462 m/day ... http://www.rodent.be/rodentnederlands/Taxonomie/muridae.htm Muridae: Taterillus petteri. Taterillus pygargus. Subfamilie Spalacinae. Nannospalax. Nannospalax ehrenbergi. Nannospalax leucodon. Nannospalax nehringi. Spalax. ... http://www.rodent.be/rodentfrans/Taxonomie/muridae.htm Muridae: Taterillus petteri. Taterillus pygargus. Genre Spalacinae. Nannospalax. Nannospalax ehrenbergi. Nannospalax leucodon. Nannospalax nehringi. Spalax. Spalax arenarius. ... http://www.allgenes.org/allgenes/servlet?page=rna&id=DT.100886882&view=nrdb allgenes.org | DoTS Transcript DT.100886882: ...chain. view, P02495, 6.6e-24, +, ALPHA CRYSTALLIN A CHAIN. view, CAC33095.1, 6.9e-24, +, alphaB-crystallin [Nannospalax ehrenbergi]. view, BAA76897 ... http://www.allgenes.org/allgenes/servlet?page=rna&id=DT.100886877&view=nrdb allgenes.org | DoTS Transcript DT.100886877: ...view, AAP31996.1, 1.4e-23, +, alpha B-crystallin [Rattus sp.]. view, CAC33095.1, 1.4e-23, +, alphaB-crystallin [Nannospalax ehrenbergi]. view, ... http://xenopus.nibb.ac.jp/cgi-bin/getBlastTax?entname=XL057n07%7C3&outfile=clone BLAST results: 50 >gi|909475|gnl|db|gp:AF078820_1 [AF078820] gi:5764680 high mobility group protein [Nannospalax ehrenbergi] Length = 215 Score = 106 bits (264), Expect = 2e ... http://xenopus.nibb.ac.jp/cgi-bin/getBlastTax?entname=rXL057n07%7C24&outfile=clone BLAST results: KP P Sbjct: 77 TYIPPKGETKKKFKDPNAP 95 >gi|909475|gnl|db|gp:AF078820_1 [AF078820] gi:5764680 high mobility group protein [Nannospalax ehrenbergi] Length = 215 ... http://www.rednova.com/news/stories/2/2003/12/30/story107.html RedNova News: A Reexamination Of Factors Influencing Philopatry In ...: ...nest or burrow may be high in some social rodents, there are solitary rodents that inhabit burrows, such as blind mole-rats (Nannospalax ehrenbergi- Nevo 1961 ... http://impact.nihs.go.jp/cgi-bin/refview/gb.AF027184 Reference: gb = AF027184: ...[ LinkDB ] LOCUS AF027184 1319 bp DNA linear ROD 05-NOV-1997 DEFINITION Nannospalax ehrenbergi 5HT1B serotonin receptor (5HT1B) gene, complete cds. ... http://eyesite.cryst.bbk.ac.uk/family83/83.fasta gi|17559394|ref|NP_506585.1| NM_074184 heat shock protein ...: ...- ... gi|13162243|emb|CAC33095.1| AJ272441 alphaBcrystallin [Nannospalax ehrenbergi] MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFSTSTSLSPFYLRPPSFFRAPSWIDTGLSEMRMEKDRFSVNLD ... http://eyesite.cryst.bbk.ac.uk/family353/353.fasta gi|7295192|gb|AAF50516.1| AE003557 Clk gene product [Drosophila ...: ...emb|CAC85404.1| AJ318058 clock protein [Nannospalax ehrenbergi carmeli] MVFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDF ... http://genome.jgi-psf.org/cgi-bin/dispGeneModel.v4?db=ciona4&id=143040 Protein Pages: Ciona intestinalis (Sea Squirt): ...genome.jgi-psf.org/cgi-bin/ dispGeneModel.v4?db=ciona4&id=143040 - 20k - Cached - Similar pages Protein Pages: Phanerochaete chrysosporium (White Rot fungus)genome.jgi-psf.org/cgi-bin/ dispGeneModel.v4?db=whiterot1&id=73034 - 22k - Cached - Similar pages[ More results from genome.jgi-psf.org ] Classification des Rodentiens ... SPALACINAE, Nannospalax Spalax, Nannospalax ehrenbergi Nannospalax leucodon Nannospalax nehringi Spalax arenarius Spalax carmeli Spalax galili Spalax golani ... http://genome.jgi-psf.org/cgi-bin/dispGeneModel.v4?db=whiterot1&id=73034 Protein Pages: Phanerochaete chrysosporium (White Rot fungus): ...genome.jgi-psf.org/cgi-bin/ dispGeneModel.v4?db=whiterot1&id=73034 - 22k - Cached - Similar pages[ More results from genome.jgi-psf.org ] Classification des Rodentiens ... SPALACINAE, Nannospalax Spalax, Nannospalax ehrenbergi Nannospalax leucodon Nannospalax nehringi Spalax arenarius Spalax carmeli Spalax galili Spalax golani ... http://perso.club-internet.fr/boudetjo/ZooList/Mammif/ClasRode.html Classification des Rodentiens: SPALACINAE, Nannospalax Spalax, Nannospalax ehrenbergi Nannospalax leucodon Nannospalax nehringi Spalax arenarius Spalax carmeli Spalax galili Spalax golani ... http://ecom2.mwgdna.com/cgi/showseq?path=DANIO_SEQ&phase=123&nt=0&seq=DRFRAMEFINDER13021 Look & Save Sequence: HMG-1) [Bos taurus]. 1, 591, 337, 6e-92, 77%, 209, 1, 209, 215, NF00059861, High mobility group protein [Nannospalax ehrenbergi]. 1, 591, 335, 1e ... http://pedant.gsf.de/cgi-bin/wwwdbp.pl?Db=Homo_sapiens_ENSEMBL_v4_28&Alias=Homo_sapiens_ENSEMBL_v4_28&Cmd=Headers&Contig=12 Homo_sapiens_ENSEMBL_v4_28: HMG1 (HMG-1). [Source:SWISSPROT;Acc:P09429] [ENSP00000255320], gene: "HMG1"; product: "high mobility group protein"; Nannospalax ehrenbergi high mobility group ... http://pedant.gsf.de/cgi-bin/wwwdbp.pl?Db=Mus_musculus_0202_int&Alias=Mus_musculus_0202_int&Cmd=Headers&Contig=15 Mus_musculus_0202_int: 1| (Z95115) bK445C9.3 (high-mobility group (nonhistone c ## 211, gene: "HMG1"; product: "high mobility group protein"; Nannospalax ehrenbergi high mobility ... http://nema.cap.ed.ac.uk/nematodeESTs/cluster.php?cluster=TCC00429 Cluster TCC00429: ...rattus] 2e-11 Contig_01_ (NM_012935) crystallin, alpha polypeptide 2 [Rattus n 2e-11 Contig_01_ (AJ272441) alphaB-crystallin [Nannospalax ehrenbergi] 2e-11 ... http://nema.cap.ed.ac.uk/nematodeESTs/cluster.php?cluster=ASC00173 Cluster ASC00173: PEST] 4e-19 Contig_01_CRAB_BOVIN Alpha crystallin B chain (Alpha(B)-crystall 2e-18 Contig_01_ (AJ272441) alphaB-crystallin [Nannospalax ehrenbergi] 4e-18 If ... http://industry.ebi.ac.uk/~alan/BioWidget/Taxonomy/tax4.data 1 root 1 2759 Eukaryotae 1 42452 unclassified eukaryotes 2759 ...: 10045 37435 Meriones shawi 10046 10047 Meriones unguiculatus 10046 10061 Spalacinae 10066 30636 Nannospalax 10061 30637 Nannospalax ehrenbergi 30636 30638 ... http://www.esapubs.org/archive/ecol/E084/094/MOMv3.3.txt AF extant Artiodactyla Bovidae Addax nasomaculatus 4.85 70000.3 60 ...: ...- ... Muridae Myomys fumatus 1.48 30 135 AF extant Rodentia Muridae Mystromys albicaudatus 1.94 86.9 129 AF extant Rodentia Muridae Nannospalax ehrenbergi 2.25 176 ... http://hydra.ics.uci.edu/blast/jf/nrResults/tab28d03.x1.html BLAST Search Results: D L + PR Q P Sbjct: 113 -FISREFHRKYRIPADVDPLAITSSLSSDGVLTVNGPRKQASGP 155 >gi|13162243|emb|CAC33095.1| alphaB-crystallin [Nannospalax ehrenbergi] Length = 170 ... http://hydra.ics.uci.edu/blast/jf/nrResults/tab79h05.x1.html BLAST Search Results: ITS++S DG+L + P+K Sbjct: 109 EHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRK 149 >gi|13162243|emb|CAC33095.1| alphaB-crystallin [Nannospalax ehrenbergi] Length = 170 ... http://bighost.area.ba.cnr.it/srs6bin/wgetz?%5Bembl-AccNumber:AF027184%5D+-e EMBL:AF027184 ID AF027184 standard; genomic DNA; ROD; 1319 BP. XX ...: 53, Created) DT 18-NOV-1997 (Rel. 53, Last updated, Version 2) XX DE Nannospalax ehrenbergi 5HT1B serotonin receptor (5HT1B) gene, complete cds. XX KW . ... http://bighost.area.ba.cnr.it/srs6bin/wgetz?%5Btaxonomy-ID:30637%5D+-e TAXONOMY:30637 ID : 30637 PARENT ID : 10062 RANK : species GC ID ...: ...species GC ID : 1 MGC ID : 2 SCIENTIFIC NAME : Spalax ehrenbergi PREFERRED COMMON NAME : Ehrenberg's mole-rat SYNONYM : Nannospalax ehrenbergi SYNONYM : Spalax ... http://www.centrcn.umontreal.ca/~bourdeav/Ribonomics/RIBO/DB_RIBO/HTML/nTBE_inv/nTBE_inv.rod.sol.filN.REP.CS.html RNA Secondary Structures: ...-- (6331 bases) |SCO: 3.02|POS:4885-4909|MIS: 0|WOB: 4| |GUUC|AC|UGGU|UCC|ACUG|GU|U|C|GAGU| --- AF027184 Nannospalax ehrenbergi 5HT1B serotonin receptor (5HT1B ... http://www.infobiogen.fr/db/cutg/CUTG/gbrod.spsum Abrothrix jelskii: 1 0 2 1 0 1 0 1 1 4 2 1 1 1 7 0 4 6 0 1 5 0 2 2 ...: 0 4 4 0 0 2 0 1 9 0 0 1 1 6 0 3 8 0 1 10 0 0 4 3 0 1 1 4 1 0 0 4 4 2 1 5 8 1 3 5 5 1 1 7 5 1 2 5 4 2 4 1 8 1 4 1 0 1 0 5 1 0 0 1 Nannospalax ehrenbergi: 10 11 ... http://bioinfo.hku.hk/db/cutg/gbrod.spsum Acomys cahirinus: 2 1 12 8 4 1 4 2 7 11 3 1 6 3 12 2 3 13 2 5 16 2 ...: 10 34 13 0 7 24 21 2 15 23 19 12 5 21 14 1 21 23 1 24 14 16 0 16 14 15 5 15 10 22 14 6 4 42 26 36 49 50 12 1 4 0 27 Mitochondrion Nannospalax ehrenbergi: 3 16 ... http://xextdb.nibb.ac.jp:8080/cgi-bin/db/ShowBlastList.sh?solver=tblastx Result of tblastx: 200201071457 XLF00043 n18b9 8e-23 87 AF078819 AF078819 AF078819 DNA 2174 Nannospalax ehrenbergi high mobility group protein (HMG1) gene, complete cds. ... http://www.lib.cas.cz/knav/journals/contents/Folia_Zoologica_9904.htm Journals published by the Academy of Sciences of the Czech ...: Feinde. (Karel Hudec) /312/ NOTES. Yüksel COªKUN New karyotype of the mole rat Nannospalax ehrenbergi from Turkey. /313-314/. Jörg ... http://www.lib.cas.cz/cgi-bin/kodovani/toASCII/www/journals/contents/Folia_Zoologica_9904.htm [an error occurred while processing this directive] Nannospalax ehrenbergi [an error occurred while processing this directive] 14326 Palestine Mole Rat Palestine Mole Rat Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |