|
|
Nyctimene albiventer - Common Tube-Nosed Fruit BatIUCN Status: Lower Risk/Least ConcernIUCN Species Profile http://www.interaktv.com/mammals/Chirop.html Biologybase: Mammals of the World: Chiroptera (Bats): Nanonycteris veldkampi. Neopteryx frosti. Nyctimene aello. Nyctimene albiventer. Nyctimene celaeno. Nyctimene cephalotes. Nyctimene certans. Nyctimene cyclotis. ... http://users.bart.nl/~edcolijn/bats.html Harpyionycteris celebensis: Remarks..... Endemic. Nyctimeninae Nyctimene albiventer. Author..... Gray, 1863 (Cynopterus albiventer). Synonym..... N. papuanus. ... http://users.bart.nl/~edcolijn/wasur.html MERAUKE: ...bat - Nyctimene aello; Common tube-nosed bat - Nyctimene albiventer; Pallas's tube-nosed fruit bat - Nyctimene sp. cf. cephalotes; Round ... http://www.batdetective.com/botw.htm bat species: Nyctimene - the tube-nosed fruit bats, Nyctimene aello, Broad striped tube. Nyctimene albiventer, Common tube nosed bat. Nyctimene celaeno, Dark tube nosed bat. ... http://www.funet.fi/pub/sci/bio/life/mammalia/chiroptera/pteropodidae/nyctimene/ Nyctimene: See [About maps]. Nyctimene albiventer (Gray, 1863) albiventer (Gray, 1863); Proc. Zool. Soc. Lond. 1863: 262, TL: Moluccas, Morotai Is. Nyctimene celaeno ... http://www.nature-conservation.or.id/bats.html CHIROPTERA: Remarks..... Endemic to New Guinea. Nyctimene albiventer. Author..... Gray, 1863 (Cynopterus albiventer). Synonym..... N. papuanus. ... http://perso.club-internet.fr/boudetjo/ZooList/Mammif/ClasChir.html Classification des Chiroptères: ...brachycephala Myonycteris relicta Myonycteris torquata Nanonycteris veldkampi Neopteryx frosti Nyctimene aello Nyctimene albiventer Nyctimene celaeno Nyctimene ... http://perso.club-internet.fr/boudetjo/ZooList/Mammif/NewSpec.html Nouvelles espèces: Guadalcanal, Nyctimene albiventer papuanus, Peterson (1991, Chauve-souris à face de singe de Berg, Montane Monkey-faced Bat, Pteralopex pulchra, Flannery, 1991. ... http://robetta.bakerlab.org/results.jsp?id=786&p=7 Robetta Structure Prediction Server Job 786 Results - F35C5.6: 48988, Nyctimene albiventer, 1 (0.07%), 2E-39, 3-179, 213-369, 165, 15, 178, gi|17980666|gb|AAL50680.1|, von Willebrand factor [Nyctimene albiventer]. ... http://www.bbc.co.uk/nature/wildfacts/factfiles/3080.shtml BBC - Science & Nature - Wildfacts - Common tube-nosed bat: Common tube-nosed bat Nyctimene albiventer Common tube-nosed bats are a type of flying fox or fruit bat. Life span Unknown. Statistics ... http://www.columbia.edu/~kj2107/publications/BatST.Phyl AAAA Paranyctimene raptor AAABAA Nyctimene aello AAABAB Nyctimene ...: ...celaeno AAABBA Nyctimene certans AAABBB Nyctimene cyclotis AAABCA Nyctimene major AAABCB Nyctimene robinsoni AAABDA Nyctimene albiventer AAABDB Nyctimene ... http://www.columbia.edu/~kj2107/research/databases/jonesbraindata.htm From: Jones, KE and A. MacLarnon. Affording larger brains: testing ...: Pteropodidae, Notopteris macdonaldi, 70.18, 1452.75, 0.00, 77; 2603, 2839. Pteropodidae, Nyctimene albiventer, 29.70, 825.00, 26.80, 0.00, 2603, 2849, 2839. ... http://www.nhm.org/research/mammals/holdings/CHIROPTE.HTM CHIROPTERA: Cameroon Ouest Prov 1 Nanonycteris veldkampi Central African Rep Ombella Mpoko Pref 1 Nyctimene aello Papua New Guinea 1 Nyctimene albiventer Papua New Guinea ... http://www.amazon.com/exec/obidos/external-search/104-5790685-6250061?mode=blended&keyword=%22Nyctimene%20albiventer%22&tag=tabularasa0f www.amazon.com/exec/obidos/external-search/104-5790685-6250061?mode=blended&keyword=%22Nyctimene%20albiventer%22&tag=tabularasa0f: Similar pages Chiroptera - Letouni ... Nyctimene aello (Thomas, 1900) - kaloň širokopruhý - Broad-striped Tube-nosed Fruit Bat Nyctimene albiventer (Gray, 1863) - kaloň - Common Tube-nosed Fruit ... http://www.savci.upol.cz/letouni.htm Bats - Order Chiroptera: Nanonycteris: Nanonycteris veldkampi. Genus Neopteryx: Neopteryx frosti. Genus Nyctimene: Nyctimene aello; Nyctimene albiventer; Nyctimene celaeno; ... http://animaldiversity.ummz.umich.edu/site/accounts/information/Nyctimene.html ADW: Nyctimene: Classification: ...bat). information. Species Nyctimene albiventer (common tube-nosed fruit bat). Species Nyctimene celaeno (dark tube-nosed fruit bat). ... http://www.bio.umass.edu/biology/dumont/Dumont-ABRC-2000.php Mammalian Morphology & Evolution Laboratory -> Presentations ...: ...behavior in five sympatric pteropodid species from New Guinea (Syconycteris australis, Dobsonia minor, Paranyctimene raptor, Nyctimene albiventer, and Pteropus ... http://it.wikipedia.org/wiki/Long_Island_(Papua_Nuova_Guinea) Long Island (Papua Nuova Guinea) - Wikipedia: ...- ... alcuno. Un Nyctimene albiventer è stato trovato morto sulla spiaggia ed è il primo avvistamento di questa specie sull’isola. ... http://www2r.biglobe.ne.jp/~fruitbat/Pteropodidae.htm 世界���ん�オオコウモリ��る�: ...broad-striped tube-nosed bat ニューギニア�インド�シア��ル マヘラ島Nyctimene albiventer ナミテングフルーツコウモリ Common ... http://www.nmnh.si.edu/msw/mammals_checklist.txt Monotremata Tachyglossidae Tachyglossus Tachyglossus aculeatus ...: ...relicta Myonycteris torquata Nanonycteris Nanonycteris veldkampi Neopteryx Neopteryx frosti Nyctimene Nyctimene aello Nyctimene albiventer Nyctimene celaeno ... http://www.amonline.net.au/collections/mammals/record.cfm?id=12 Australian Museum Collections - Mammalogy Collection Gallery: Chiroptera - bats. Registration Number: M21773. Scientific Name: Nyctimene albiventer. Common Name: Common tube-nosed bat. Dimensions: 2.5cm long. ... http://pssn.bahaykuboresearch.net/04/abstracts/0006.htm PSSN Convention 2004 Abstracts: All bats are megachiropteran fruit bats in the family of Pteropodidae: Dobsonia minor, Syconycteris australis, Nyctimene albiventer, Nyctimene draconilla and ... http://www.gettysburg.edu/academics/bio/460abstractsspring2001.htm THE EFFECTS OF SEED MASS ON SEEDLING GROWTH RATE: Nyctimene albiventer. ... Common Tube-Nosed Bats, Nyctimene albiventer (Pteropodidae), are solitary and roost primarily in foliage in tropical lowlands. ... http://www.wetlands.or.id/irj20.htm WDB-WASUR: Nyctimene aello, Broad-striped Tube-nosed Bat. Nyctimene albiventer, Common Tube-nosed Bat. Nyctimene cephalotes, Pallas Tube-nosed Fruit Bat. ... http://www.pnas.org/cgi/content/full/94/11/5716 PNAS -- Hollar and Springer 94 (11): 5716: ...the rousettine section; Epomophorus wahlbergi is in the epomophorine section; Cynopterus brachyotis, Thoopterus nigrescens, Nyctimene albiventer, and Nyctimene ... http://www.batcon.org/schol/web00sum.html BCI's 2000 Student Scholarship Program Summary: Location: O-Pio, Crater Mountain Wildlife Management Area, Chimbu Province, PAPUA NEW GUINEA Species: Ecology of Nyctimene albiventer, N. cyclotis, N. aello, N ... http://www.gpcr.org/7tm/seq/DR/Q8SQ95.TABDR.html GPCRDB Cross References for Q8SQ95: Description, Alpha 2B adrenergic receptor (Fragment). Gene, ADRA2B. Organism, Nyctimene albiventer (Common tube-nosed fruit bat). Chromosomal location, -. ... http://meetings.cshl.org/tgac/tgac/results/02pairwise/mysteryblastxtax.htm Tax BLAST Report: Nyctimene albiventer (tube-nosed fruit bat) .... 156 2 hits [mammals] (AJ419805) alpha 2B adrenergic receptor [Nyctimene albivent . . ... http://www.bioone.org/bioone/?request=get-document&issn=0022-2372&volume=085&issue=01&page=0008 FOOD HARDNESS AND FEEDING BEHAVIOR IN OLD WORLD FRUIT BATS ...: ...on 5 sympatric species from Papua New Guinea: Pteropus conspicillatus, Dobsonia minor, Syconycteris australis, Paranyctimene raptor, and Nyctimene albiventer. ... http://www.bioone.org/bioone/?request=get-document&issn=0022-2372&volume=084&issue=02&page=0561 HOME RANGE AND TERRITORIALITY IN THE LEAST BLOSSOM BAT, <GENSP> ...: ...al. 2000 ), Dobsonia minor (Bonaccorso et al. 2002 ), and ongoing research on Nyctimene albiventer and Melonycteris melanops. Mist ... http://genome.jouy.inra.fr/db/gcg/embl/em_om_000.seq Q9N1N1 6/2003 ASCII Len: 159 Q9n1n1 papio hamadryas (hamadryas ...: 3/2004 PLGFTFSFPCKQTSLDAGILITWTKGFKATDCVGHDVA >>>>Q8SQF9 6/2003 ASCII Len: 915 Q8sqf9 nyctimene albiventer (common tube-nosed fruit bat). brca1 (fragment). ... http://genome.jouy.inra.fr/db/gcg/embl/em_om_000.ref Q9N1N1 ID Q9N1N1 PRELIMINARY; PRT; 159 AA. AC Q9N1N1; DT 01-OCT ...: 21, Last sequence update) DT 01-JUN-2003 (TrEMBLrel. 24, Last annotation update) DE BRCA1 (Fragment). OS Nyctimene albiventer (Common tube-nosed fruit bat). ... http://bioinformatics.weizmann.ac.il/databases/embl/align/ds35643.dat Title: Mammalian mitochondrial 12S rRNA sequences AUTHOR: Marc W. ...: ...leschenaulti Pteropodidae Nyctimene albiventer U61077; Springer and Douzery (1996) Microchiroptera/Vespertilionidae/Eptescius U61082; Springer and Douzery ... http://www.psb.ugent.be/rRNA/ssu/list/Mitochondria.html ssu rRNA Mitochondria: Nyctea scandiaca U83750; Mit. Nyctinomops macrotis AF263217; Mit. Nyctimene albiventer U61077; Mit. Nyctiphrynus mcleodii U89215; Mit. ... http://www.infobiogen.fr/db/index-lassap/sptrembl/mam.seq Q9N1N1 #AC Q9N1N1; #OS PAPIO HAMADRYAS (HAMADRYAS BABOON). #DE ...: KW KINASE. PLGFTFSFPCKQTSLDAGILITWTKGFKATDCVGHDVA >Q8SQF9 #AC Q8SQF9; #OS NYCTIMENE ALBIVENTER (COMMON TUBE-NOSED FRUIT BAT). #DE BRCA1 (FRAGMENT). ... http://www.infobiogen.fr/db/embl-align/ds38659.dat TITLE: Alignment of 12S rRNA sequences from 118 mammalian taxa ...: ...forsteri Y08527 SCO Stenella coeruleoalba X78168 BPH Balaenoptera physalus X61145 BMU Balaenoptera musculus X72204 NAL Nyctimene albiventer U61077 RLE ... http://algo.inria.fr/vandenbogaert/RE/NetBlast/M.MwoI.netblast TBLASTN 2.2.5 [Nov-16-2002] Reference: Altschul, Stephen F. ...: 40 1.6 gb|AE000405.1|AE000405 Escherichia coli K12 MG1655 section 295 o... 40 1.6 gb|AF447502.1| Nyctimene albiventer BRCA1 gene, partial cds 40 1.6 dbj ... http://apt.allenpress.com/aptonline/?request=get-abstract&issn=0022-2372&volume=085&issue=01&page=0008 FOOD HARDNESS AND FEEDING BEHAVIOR IN OLD WORLD FRUIT BATS ...: Individuals of Syconycteris australis, Dobsonia minor, Pteropus conspicillatus, Nyctimene albiventer, and Paranyctimene raptor were videotaped during feeding ... http://www.chickest.udel.edu/orthomouse/m273.html BLAST Search Results: 70 4e-10 emb|AJ278159.1|CUN278159 Cabassous unicinctus partial vWF g... 70 4e-10 gb|AF447549.1| Nyctimene albiventer von Willebrand factor (... ... http://www.chickest.udel.edu/orthochick/c140.html BLAST Search Results: 87 3e-14 gb|AF447549.1| Nyctimene albiventer von Willebrand factor (... 87 3e-14 emb|AJ238387.1|CVA238387 Ctenodactylus vali vWF gene (parti... ... http://www.esapubs.org/archive/ecol/E084/094/MOMv3.3.txt AF extant Artiodactyla Bovidae Addax nasomaculatus 4.85 70000.3 60 ...: ...- ... minimus 1.2 15.9 153 AUS extant Chiroptera Pteropodidae Melonycteris melanops 1.69 49 153 AUS extant Chiroptera Pteropodidae Nyctimene albiventer 1.48 29.9 153 ... http://www.rickertweb.com/~justin/School/CS360%20Database%20Systems/PC2/SQL/2b.txt SQL> @c:\2b.sql NAME PRINTNAME ...: Hypsignathus monstrosus Megaerops wetmorei Myonycteris torquata Myonycteris torquata Nyctimene albiventer Nyctimene cephalotes Nyctimene cephalotes Nyctimene ... http://www.rickertweb.com/~justin/School/CS360%20Database%20Systems/PC4/Data/TAXON/BATS1.txt ME MYPARENT RORDER NAME TAXON PRINTNAME AUTHOR CITATION COMMON_NM ...: 7, 5:216. Papua New Guinea, Milne Bay Prov., Milne Bay. New Guinea. 231 229 0 albiventer SPECIES Nyctimene albiventer (Gray, 1863). Proc. Zool. Soc. ... http://industry.ebi.ac.uk/~alan/BioWidget/Taxonomy/tax4.data 1 root 1 2759 Eukaryotae 1 42452 unclassified eukaryotes 2759 ...: Tupaia glis belangeri 9395 9397 Chiroptera 9347 30559 Megachiroptera 9397 9398 Pteropodidae 30559 48987 Nyctimene 9398 48988 Nyctimene albiventer 48987 42146 ... http://rdp.cme.msu.edu/download/SSU_rRNA/SSU_Mito.alpha (July 31, 1998) MITOCHONDRIAL SMALL SUBUNIT rRNA: ALPHABETICALLY ...: Nyctibora azteca (cockroach) -- mitochondrion [280] Nyct.lut_M Nyctibora lutzi (cockroach) -- mitochondrion [1323] Nyme.alb_M Nyctimene albiventer (tube-nosed ... http://www.icb.ufmg.br/~lgb/schisto/blastNT/Contig1038.htm BLAST Search Results: 161 1e-36 gb|M77102.1|MUSMTDNAE Mus setulosus mitochondrion DNA fragment 161 1e-36 gb|AF293640.1|AF293640 Nyctimene albiventer 16S ribosomal R... 159 4e-36 gb ... http://www.esi.umontreal.ca/~bourdeav/HH/DB_HH/HTML/HH-II-iiUA/HH-II-iiUA.mam.sol.filN.html HH-I-3: 80 nuc ..|UU|U|UAA|GGGU|UUG|CUGAAGA|UGG| --- NAU61077 Nyctimene albiventer 12S ribosomal RNA gene, partial sequence, and --- (1030 bases ... http://www.planet-mammiferes.org/MammifPM/NewSpec.html [an error occurred while processing this directive] Nyctimene albiventer [an error occurred while processing this directive] 14962 Common Tube-Nosed Fruit Bat Common Tube-Nosed Fruit Bat Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |