Ommatophoca rossii - Ross Seal

IUCN Status: Lower Risk/Least Concern
IUCN Species Profile
SCS: Ross Seal (Ommatophoca rossii): Ross Seal (Ommatophoca rossii). Distribution and Numbers Named after the British explorer who obtained the first specimen, less is ...
http://www.pinnipeds.org/species/species.htm

Seal Conservation Society: Species Index Page: Hawaiian Monk Seal Monachus schauinslandi, Ross Seal Ommatophoca rossii, ...
http://www.70south.com/resources/animals/seals/ross

Ross Seal (Ommatophoca rossii): Ross Seal (Ommatophoca rossii). Content contributed and copyright Jeroen Francois (Het Laatste Continent). The Ross seal is the smallest ...
http://animaldiversity.ummz.umich.edu/site/accounts/classification/Ommatophoca_rossii.html

ADW: Ommatophoca rossii: Classification: Ommatophoca rossii (Ross seal). Information; Classification. ... Parent taxa. Genus Ommatophoca (Ross seal). information. Species Ommatophoca rossii (Ross seal). ...
http://animaldiversity.ummz.umich.edu/site/accounts/information/Ommatophoca_rossii.html

ADW: Ommatophoca rossii: Information: Ommatophoca rossii. Ommatophoca rossii (Ross seal). ... Carnivora. Family: Phocidae. Genus: Ommatophoca. Species: Ommatophoca rossii. Geographic Range. Ross ...
http://www.itis.usda.gov/servlet/SingleRpt/SingleRpt?search_topic=TSN&search_value=180665

ITIS Standard Report Page: Ommatophoca rossii: Go to Print Version, Ommatophoca rossii Gray, 1844 Taxonomic Serial No.: 180665. ... Species, Ommatophoca rossii Gray, 1844 -- bigeyed seal, Ross seal, References, ...
http://www.itis.usda.gov/servlet/SingleRpt/SingleRpt?search_topic=TSN&search_value=180664

ITIS Standard Report Page: Ommatophoca: Genus, Ommatophoca Gray, 1844, Direct Children: Species, Ommatophoca rossii Gray, 1844 -- bigeyed seal, Ross seal, References, Expert(s): Expert: Alfred L. Gardner, ...
http://nmml.afsc.noaa.gov/gallery/pinnipeds/galleryp/pages/olross.htm

olross: Management Auke Bay Laboratory. Pinniped Photo Gallery. Ross Seal. Previous Gallery Next. Ommatophoca rossii. Photo by Mike Cameron, NMML.
http://nmml.afsc.noaa.gov/PolarEcosyst/Antarticecosys.htm

Antarctic Ecosystems: ...and abundance. Research is also being conducted on leopard seals (Hydrurga leptonyx) and Ross seals (Ommatophoca rossii). Field ...
http://www.rsnz.org/publish/nzjz/2000/16.php

Splettstoesser et al.--Antarctic wildlife - Ross seals and emperor ...: New Zealand Journal of Zoology abstracts. Notes on Antarctic wildlife: Ross seals Ommatophoca rossii and emperor penguins Aptenodytes forsteri. ...
http://www.rsnz.org/publish/nzjz/2000/

New Zealand Journal of Zoology 2000: Notes. Notes on Antarctic wildlife: Ross seals Ommatophoca rossii and emperor penguins Aptenodytes forsteri JOHN F. SPLETTSTOESSER, MARIA GAVRILO, CARMEN FIELD ...
http://library.thinkquest.org/26442/html/life/seal.html

Life on Antarctica: Seals: They reach sexual maturity at three years. Ross Seal. Ross seal Ommatophoca rossii is the smallest with a length of 2.3m and weight up to 200kg. ...
http://www.onlinezoologists.com/topics/marspec/pms_pin_spc.html

Online Zoologists: Pinnipeds: Odobenus rosmarus; Ommatophoca rossii; Otaria byronia; Phoca caspica; Phoca fasciata; ... World Wide Walrus. [Top]. Ommatophoca rossii. TBD. [Top]. Otaria byronia. TBD. [Top]. ...
http://www.imma.org/pinnipeds/

Marine Mammal Factsheets: Antarctic seals, crabeater seal, Lobodon carcinophagus. Ross seal, Ommatophoca rossii. leopard seal, Hydrurga leptonyx. Weddell seal, Leptonychotes weddellii. ...
http://www.net-lexikon.de/Hundsrobben.html

Lexikon - Hundsrobben Definition Erklärung Bedeutung: ...- ... angustirostris); Südlicher See-Elefant (Mirounga leonina). Gattung Ommatophoca: Ross-Robbe (Ommatophoca rossii). Gattung Lobodon: Krabbenfresser ...
http://www.iespana.es/natureduca/ant_legis_anexo2prot.htm

ANT�RTIDA - LEGISLAC. - DOC.: Anexo II Prot. M. Ambiente: ...- ... APENDICE A ESPECIES ESPECIALMENTE PROTEGIDAS. Todas las especies del género Arctocephalus, focas peleteras, Ommatophoca rossii, forca de Ross. ...
http://www.infochembio.ethz.ch/links/zool_saeuget_robben.html

Robben: Säugetiere: ...- ... Ross Seal - Text and Image. Ross Seal (Ommatophoca rossii) - Text and Images. Saimaa Ringed Seal (Phoca hispida saimensis) - Text and Image. ...
http://rimmer.design1.com.au/mammals/contents.html

Mammals of the Ice: Information: Crabeater seal (Lobodon carcinophagus); Leopard seal (Hydrurga leptonyx); Ross seal (Ommatophoca rossii); Southern elephant seal (Mirounga leonina). ...
http://www.cephbase.utmb.edu/prddb/pred.cfm?CephID=311

CephBase - Cephalopod (Octopus, Squid, Cuttlefish and Nautilus) ...: Ross seal (Ommatophoca rossii), Antarctic Ocean, (Clarke, MR,1983). Ross seal (Ommatophoca rossii), Antarctic pack ice zone, (Klages NTW,1996). ...
http://www.cephbase.utmb.edu/prddb/pred.cfm?CephID=337

CephBase - Cephalopod (Octopus, Squid, Cuttlefish and Nautilus) ...: Southern elephant seal (Mirounga leonina), South Orkney Islands, (Klages NTW,1996). Ross seal (Ommatophoca rossii), Antarctic pack ice zone, (Klages NTW,1996). ...
http://www.terrambiente.org/fauna/Mammiferi/carnivora/phocidae/

I Focidi o Foche: ...- ... Monachus tropicalis: Ommatophoca, ommatophoca_rossii.jpg (185319 byte), Ommatophoca rossii. Phoca, phoca_vitulina4.jpg (397731 byte), Phoca ...
http://pal.lternet.edu/projects/biodiversity/species/mammals

9 !mammals nodc# name type-T=taxon on which genus based code-P ...: LOBODON CARCINOPHAGUS,,S,, ,1,2, 9221030601,CRABEATER SEAL,,S,C,REEVES-1992,1,2,1 92210307,OMMATOPHOCA,,G,, ,1,2, 9221030701,OMMATOPHOCA ROSSII,,S,, ,1,2 ...
http://pal.lternet.edu/projects/biodiversity/species/vertebrate.lis

Palmer LTER Vertebrate Species Inventory: Birds and Mammals Birds ...: Leopard seal Leptonychotes weddellii Weddell seal Lobodon carcinophagus Crabeater seal Mirounga leonina Southern elephant seal Ommatophoca rossii Ross' seal ...
http://www.antarctica.ac.uk/About_Antarctica/Wildlife/Whales_and_Seals/

Whales and Seals: Leopard ( Hydrurga leptonyx ) and Ross seals ( Ommatophoca rossii ) tend to be solitary, whereas Weddell ( Leptonychotes weddellii ) and Crabeater seals ...
http://www.antarctica.ac.uk/About_Antarctica/Treaty/Flora_and_Fauna.html

Agreed Measures for the Conservation of Antarctic Fauna and Flora ...: ANNEX A: Specially Protected Species. All species of the genus Arctocephalus , Fur Seals. Ommatophoca rossii , Ross Seal. ANNEX B: Specially Protected Areas. ...
http://www.antarcticconnection.com/antarctic/wildlife/seals/ross.shtml

Ross Seals - Wildlife of Antarctica - Antarctic Connection: Back to Main Seal Page. Species: Ross Seal. Ommatophoca Rossii. Quick Facts: Population: 200,000 individuals. Location: Most Antarctic waters. Size: Up to 12 feet. ...
http://www.shaman.cz/Carnivora/Phocidae.htm

Shaman.cz - Carnivora - Tuleňovité šelmy (Phocidae): Tuleň havajský; Druh Monachus tropicalis - Tuleň karibský. Rod Ommatophoca: Druh Ommatophoca rossii - Tuleň Rossův. Rod Phoca: Druh ...
http://www.mmc.gov/species/speciesglobal.html

Marine Mammal Commission: Simple Global Species List: Ribbon seal, Phoca fasciata. Ringed seal, Phoca hispida. Ross seal, Ommatophoca rossii. South African and Australian fur seals, Arctocephalus pusillus. ...
http://www.mmc.gov/species/speciesglobal2.html

Marine Mammal Commission: Scientific Global Species List: Cystophora cristata, Hooded seal. Halichoerus grypus, Gray seal. Lobodon carcinophagus, Crabeater seal. Ommatophoca rossii, Ross seal. Hydrurga leptonyx, Leopard seal. ...
http://213.60.131.138/pescadigital/diccionario/letraF.htm

Gran Diccionario de Especies: ...- ... Foca de Groenlandia, Phoca groenlandica, Harp seal, Phoque du Groenland, Phocidae. Foca de Ross, Ommatophoca rossii, Ross seal, Phoque de Ross, Phocidae. ...
http://personal5.iddeo.es/erimar/focas.htm

Focas: ...- ... Pueden llega a medir 6 metros. (Phoca fasciata). Ommatophoca rossii. Foca Arpa (Phoca groenlandica). Elefante marino norteño (Mirounga angustirostris).
http://mywebpages.comcast.net/kils/wiley/

Euphausia superba filtering basket in Nature of Biology Book 1 ...: ...hunted by various seals - the Wedell seal (Leptonchotes wedellii), the southern elephant seal (Mirounga leonina), the Ross seal (Ommatophoca rossii) and the ...
http://www.hetlaatstecontinent.be/natuur/robben/rosszeehond.html

Antarctica, Het Laatste Continent - Dierenwereld - Rosszeehond: 4. Dierenwereld - Robben Rosszeehond (Ommatophoca rossii). De Rosszeehond is de kleinste, minst talrijke en minst bestudeerde antarctische robbensoort. ...
http://www.medioambiente.gov.ar/fauna/pinnipedos/default.htm

DFS - Pinnípedos del Mar Argentino: ...- ... Mirounga leonina Lobodon carcinophagus Hydrurga leptonyx Leptonychotes weddellii Ommatophoca rossii. ...
http://www.medioambiente.gov.ar/mlegal/icticolas/res351_anexI.htm

Marco legal - Resolución 351/95, Anexo I: ...- ... Foca cangrejera, Lobodon carcinophagus. Foca de Ross, Ommatophoca rossii. Foca de Weddell, Leptonychotes weddellii. Foca Leopardo, Hydrurga leptonyx. ...
http://perso.club-internet.fr/boudetjo/ZooList/Mammif/ClasPinn.html

Classification des Pinnipèdes: ...weddellii Lobodon carcinophagus Mirounga angustirostris Mirounga leonina Monachus monachus Monachus schauinslandi Monachus tropicalis Ommatophoca rossii. ...
http://www.mepas.it/antartide/fauna_2.htm

fauna 2: ...- ... La foca di Ross (Ommatophoca rossii) è rara e solitaria; infatti, essa vive singolarmente od in piccoli gruppi ben distanziati tra loro. ...
http://www.seapics.com/picture_gallery/pinniped/true_seal/

Seal Pictures: ...seal, Phoca hispida, on sea ice, Greenland (N. Atlantic) #009499-1 © Bryan & Cherry Alexander / Seapics.com, Ross seal, Ommatophoca rossii, rarely observed and ...
http://www.oceanlaw.net/netpath/page6-psi.htm

Part 6: Pinnipeds (Species Information): Antarctic seals. crabeater seal Lobodon carcinophagus, pagophilus.org, SCS, CITES, Ross seal Ommatophoca rossii, pagophilus.org, SCS, CITES, ...
http://www.wingz.co.jp/MMSDB/FclassE.html

classF: Mirounga leonina Southern elephant seal. Lobodon carcinophagus Crabeater seal. Ommatophoca rossii Ross seal. Hydrurga leptonyx Leopard seal. ...
http://www.seaworld.org/wild-world/zoo-research/antarctic-study-trip/ross.htm

Ross seal: Ross seals Ommatophoca rossii. Ross seals are named for James Clark Ross, the commander of the HMS Erebus, an British exploration ...
http://www.damisela.com/zoo/mam/carnivora/phocidae/rossi/biblio.htm

Foca de Ross: ...- ... Thomas, Jeanette A. 2002. Ross Seal Ommatophoca rossii en Encyclopedia of Marine Mammals Perrin, William F., Bernd Würsig y JGM Thewissen. Editores. ...
http://www.deh.gov.au/coasts/species/seals/

Marine Species Conservation - Seals and Sea Lions: Leopard seal, Hydrurga leptonyx. Crab-eater seal, Lobodon carcinophagus. Weddell seal, Leptonychotes weddellii. Ross seal, Ommatophoca rossii. ...
http://www.deh.gov.au/epbc/biodiversityconservation/listedmarine.html

EPBC Act - Listed marine species: Leptonychotes weddellii – Weddell seal. Mirounga leonina – Southern elephant seal. Ommatophoca rossii – Ross seal. Order Crocodilia. ...
http://www.hswri.org/research/publications.cfm

HSWRI - Recent Publications: 1999. Bengtson, JL, and BS Stewart.rt. Diving patterns of a Ross seal (Ommatophoca rossii) in the western Weddell Sea. Polar Biology, 17: 214-218. 1997. ...
http://www.hswri.org/aboutUs/scientistDisplay.cfm?sciID=7

HSWRI - Scientists: Bengtson, JL, and BS Stewart.rt. Diving patterns of a Ross seal (Ommatophoca rossii) in the western Weddell Sea. Polar Biology, 17: 214-218. 1997. ...
http://members.tripod.com/seongjins2/bio/seal.htm

바다표범: ...표범해표는 성격� �악하여 때때로 사람� 공격하기� 한다. 로스해표(Ross Seal:Ommatophoca rossii). ...
http://home.globalcrossing.net/~brendel/carniv.html

ORDER CARNIVORA: Monachus monachus Monachus schauinslandi. Monachus tropicalis. Genus Ommatophoca. Ommatophoca rossii. Genus Phoca. Phoca caspica Phoca fasciata. Phoca groenlandica. ...
http://sege.ntu.edu.sg/cgi-bin/extract_info.pl?dbase=gbmam&field=protein&pop=131&type=1

Your Search Results: TWAKSRSTITRNTNENTVTLKMTSLTAADTATYFCARGGPDDSANYNDKIDLWGP > 54834_AY131996 Ommatophoca rossii MHC class II DO alpha (HLA-DOA) gene, exons 2and 3 and partial cds ...
http://sege.ntu.edu.sg/cgi-bin/extract_info.pl?dbase=gbmam&field=exon&pop=229&type=1

Your Search Results: Your Search Results. click here for format explanation Phase Colours={0}{1}{2}. > 54834_AY131996 Ommatophoca rossii MHC class II DO alpha (HLA-DOA) gene, exons ...
http://www.gma.org/marinemammals/phocidae.html

GMA / Carivore Family - Phocidae: Monachus monachus (Mediterranean Monk Seal) Monachus tropicalis (Caribbean Monk Seal) Monachus schauinslandi (Hawaiian Monk Seal) Ommatophoca rossii (Ross Seal ...
http://www.phthiraptera.org/Mammals/Phocidae.html

Mammals: Phocidae: Seal Ommatophoca. Ommatophoca rossii Gray, 1844 - Ross' Seal Antarctophthirus mawsoni Harrison, 1937 *. Phoca - Common Seals. Phoca ...
http://archive.greenpeace.org/oceans/piratefishing/soeco.html

Oceans - Stop Pirate Fishing: Other fish-eating species include the Weddell seal, Ross seal (Ommatophoca rossii), Antarctic fur seal (Arctocephalus gazella) and the largest species of all ...
http://archive.greenpeace.org/oceans/southernoceans/expedition2000/spanish/sp_southernocean.html

Greenpeace: More Info: ...- ... Otras especies comedoras de pescado incluyen a las focas de Weddell (Lemonychotes weddelli), focas de Ross (Ommatophoca rossii), elefantes marinos meridionales ...
http://www.eaam.org/Abstracts/am_29_2.htm

Aquatic Mammals 29(2) abstracts: ...better-studied species, some testable hypotheses are proposed for further investigations of spotted (Phoca largha), Ross (Ommatophoca rossii), Hawaiian monk ...
http://web.tiscali.it/zoonomia/mammiferi/main02.htm

Zoönomia: ...- ... Sud. Lobodon carcinophagus Foca carcinofaga oppure Foca cancrivora. Ommatophoca rossii Foca di Ross. Hydrurga leptonyx Foca leopardo. ...
http://polarmet.mps.ohio-state.edu/ASPIRE_99/seals/econ/sepab.htm

Human Impacts: Sealing: The other seals, namely, the leopard and Ross (Ommatophoca rossii), constitute slightly more than 2.5% of the Antarctic seal populations and have not been ...
http://polarmet.mps.ohio-state.edu/ASPIRE_99/seals/science/spcptxt.htm

Species Composition: Text: Leopard Seal, Hydrurga leptonyx. Ross Seal, Ommatophoca rossii. Weddell Seal, Leptonychotes weddellii. Southern Elephant Seal, Mirounga leonina. ...
http://www.polar.se/antarktis/lagar_regler/annex_II.html

Annex II: Appendices to the Annex. Appendix A: Specially Protected Species All species of the genus Arctocephalus, Fur Seals. Ommatophoca rossii, Ross Seal. Appendix B: ...
http://www.lighthouse-foundation.org/lighthouse-foundation.org/explorer/ausbeutung.shtml

Ausbeutung mariner Ressourcen: ...- ... Andere Robbenarten einschließlich der Krabbenfresser- (Lobodon carcinophagus), Weddell-(Leptonychotes weddellii) und Ross-Robbe (Ommatophoca rossii) sowie des ...
http://www.lighthouse-foundation.org/lighthouse-foundation.org/eng/explorer/exploitation.shtml

Exploitation: ...including Crabeater (Lobodon carcinophagus), Weddell (Leptonychotes weddellii), Leopard (Hydrurga leptonyx) and Ross seals (Ommatophoca rossii) were taken ...
http://www.isset.org/doc.php?pagelocation=26&doc=942

International Space School Educational Trust ISSET: Monachus tropicalis (Caribbean Monk Seal). Monachus schauinslandi (Hawaiian Monk Seal). Ommatophoca rossii (Ross Seal). *Found in the Gulf of Maine. ...
http://www.bioone.org/bioone/?request=get-citation-links&doi=10.1043/0310-0049(1991)014%3C0035:MOTRTO%3E2.0.CO;2&id=I0022-2372-081-01-0134-TEDMAN1&sitename=BIOONE

Citation Links: CITATION Tedman, RA Morphology of the reproductive tract of a juvenile male Ross seal, Ommatophoca rossii (Pinnipedia: Phocidae) Australian Mammalogy 1991 vol. ...
http://www.rtis.com/nat/user/elsberry/taxa/pin.html

Online Zoologists: Pinnipeds: Genus Ommatophoca: Species Ommatophoca rossii ("Ross Seal"): TBD. Genus Hydrurga: Species Hydrurga leptonyx ("Leopard Seal"): TBD. Genus ...
http://www.env.go.jp/earth/nankyoku/kankyohogo_en/kankyo_en/hogo/kokunai/

Efforts to Protect Antarctica in Japan: Subantarctic fur seal(Arctocephalus tropicalis), Ross seal(Ommatophoca rossii), that are determined by the Minister of the Environment of Japan. ...
http://208.164.121.55/reference/narwhal/martops.htm

Encyclopedia of Marine Mammals: Articles by Section: ...and Baikal Seals (Pusa hispida, P. caspica, and P. sibirica) Risso's Dolphin (Grampus griseus) River Dolphins Ross Seal (Ommatophoca rossii) Rough-Toothed ...
http://208.164.121.55/reference/narwhal/mararts.htm

Encyclopedia of Marine Mammals: Topic List: Grampus griseus) River Dolphins River Dolphins, Evolutionary History River Dolphins, Relationships Rookeries Ross Seal (Ommatophoca rossii) Rough-Toothed ...
http://www.fao.org/docrep/T0725E/t0725e0g.htm

Ch16: 456) . . . .r) Ross seal (Ommatophoca rossii). Fig. 455 Leptonychotes weddellii. Fig. 456 Ommatophoca rossii. 25a. ...
http://www.fao.org/docrep/T0725E/t0725e00.htm

Contents: ...schauinslandi [PHOC Mona 3] Mirounga angustirostris [PHOC Mir 2] Mirounga leonina [PHOC Mir 1] Lobodon carcinophagus [PHOC Lob 1] Ommatophoca rossii [PHOC Omm 1 ...
http://www.isealife.com/Mammals%20page.htm

iSealife.com: Monachus schauinslandi Hawaiian Monk Seal(ENDANGERED). Monachus tropicalis West Indian Monk Seal. Ommatophoca rossii Ross' Seal. Phoca caspica Caspian Seal. ...
http://blog.lide.cz/janulacek/zviratka/

Januláèkùv blog: ...leptonyx, feeding on penguin, Antarctica, young ringed seal, Phoca hispida, on sea ice, Greenland (N. Atlantic), Ross seal, Ommatophoca rossii, rarely observed ...
http://www.eswr.com/pn100402a.htm

[Federal Register: October 4, 2002 (Volume 67, Number 193)] ...: ...instrument, and incidentally harass crabeater seal (Lobodon carcinophagus), leopard seal (Hydrurga leptonyx), Ross seal (Ommatophoca rossii), southern elephant ...
http://www.scar.org/Treaty/CEP%20III%20Papers/WP%20Prot%20Specs.html

DRAFT PAPER: ...ii) data on the Ross seal Ommatophoca rossii are as yet incomplete, and on a precautionary basis this species should remain on the list until the Antarctic ...
http://www.oceanwanderers.com/Mammals.html

Annotated List of the Marine Mammals of the World: Monachus schauinslandi Hawaiian Monk Seal (ENDANGERED). Monachus tropicalis West Indian Monk Seal. Ommatophoca rossii Ross' Seal. Phoca caspica Caspian Seal. ...
http://www.biologybrowser.org/bb/Organism/Chordata/Vertebrata/Mammalia/Carnivora/Phocidae/index2.shtml

BiologyBrowser: Organism Resources and Links: ...to other resources; Ommatophoca rossii (Ross Seal) species account, UMMZ; Phoca caspica species account, UMMZ; Phoca fasciata species ...
http://www.marine-mammals.de/species/species_pin.htm

Robben: ...- ... streng vor kommerzieller Ausbeutung geschützt. Rossrobbe (Ommatophoca rossii). Population: ca. 200.000 Lebensraum: zirkumpolar in ...
http://www.kesti.co.kr/antarctica/Biology/SeaLeopard.htm

남극� �물 - 바다표범: ...여겨진다. ▶ Leopard Seal� 성격� �악하여 때때로 사람� 공격하기� 한다. Ross Seal(Ommatophoca rossii). 2.3 ...
http://www.biologiamarina.com/dev/projects/read.asp?pid=9&docid=34

Biología Marina - Leer: ...- ... Monachus schauinslandi Matschie, 1905. Monachus tropicalis (Gray, 1850). Ommatophoca rossii Gray, 1844. Phoca caspica Gmelin, 1788. Phoca fasciata Zimmermann, 1783. ...
http://www.concytec.gob.pe/odci/odci/ambiente-anx2.htm

Tratado: ...- ... APENDICE AL ANEXO II APENDICE A ESPECIES ESPECIALMENTE PROTEGIDAS Todas las especies del género Arctocephalus, focas peleteras, Ommatophoca rossii, forca de ...
http://www.epa.gov/fedrgstr/EPA-IMPACT/2002/July/Day-12/i17556.htm

EPA: Federal Register: Marine Mammals; File Nos. 782-1676 and 1032 ...: ...that may be incidentally taken are crabeater seal (Lobodon carcinophagus), leopard seal (Hydrurga leptonyx), Ross seal (Ommatophoca rossii), southern elephant ...
http://www.epa.gov/fedrgstr/EPA-IMPACT/2000/November/Day-15/i29269.htm

EPA: Federal Register: Marine Mammals; File No. 87-1593: ...annually, and up to 10 each: Leopard seals (Hydrurga leptonyx), Weddell seals (Leptonychotes weddellii) and Ross seals (Ommatophoca rossii) in Antarctica. ...
http://www.mavicanet.ru/directory/rus/28235.html

Тюлени РоÑ?Ñ?а (Ommatophoca) - MavicaNET: Выделить Ñ?айт, Ross Seal (Ommatophoca rossii) - English URL: http://www.70south.com/resources/animals/seals/ross. Information ...
http://www.mavicanet.ru/directory/eng/28235.html

Ross Seals (Ommatophoca) - MavicaNET: Select site, Ross Seal (Ommatophoca rossii) - English URL: http://www.70south.com/resources/animals/seals/ross. Information on all the Antarctic Seals. [eng]. ...
http://www.iobis.org/pls/OBISIND/obis_data.obis_search?category=VMPi&names=all

OBIS Search Result: ...of Life Ommatophoca rossii Ross' seal a seal/sea lion/walrus No distribution data currently available Y Catalogue of Life; ITIS query Cat. ...
http://www.farn.org.ar/docs/p09/publicaciones9-4pie.html

FARN - Aspectos Jurídicos Relevantes...(4): ...- ... VolverVolver. 4. Indicadas en el Apéndice A del Anexo II: todas las especies del género arctocephalus, focas peleteras, ommatophoca rossii, foca de Ross. ...
http://www.jura.uni-sb.de/BGBl/TEIL1/1994/19942599.1.HTML

Bundesgesetzblatt 1994 Teil I Seite 2599: ...- ... bleiben. (4) Alle Arten der Gattung Arctocephalus (Pelzrobben) und Ommatophoca rossii (Ross-Robben) stehen unter besonderem Schutz. ...
http://www.kcls.org/hh/oceans/pinniped.cfm

Homework Help--Animals, Insects & Birds--Pinnipeds: Association. Ross Seal (Ommatophoca rossii) Distribution and numbers, status, lifestyle and statistics from the Seal Conservation Society. ...
http://www.gerhard.de/gerold/owa/gerhard.browsen_soif?form_seq=1778804&form_timestamp=&form_language=0

conservation of antarctic fauna and flora: ...received by the depositary. all species of the genus arctocephalus, fur seals. ommatophoca rossii, ross seal. the following animals and ...
http://www.birdlist.org/biodiversity/mammals/allmammals/mammallist3.htm

Mammallist3: CARNIVORA, Phocidae, Monachus, tropicalis, Caribbean Monk Seal, (Gray, 1850). CARNIVORA, Phocidae, Ommatophoca, rossii, Ross' Seal, Gray, 1844. ...
http://www.inach.cl/antartica/mamiferos.html

Flora y Fauna: ...- ... archipiélago de Juan Fernández. 5. Foca de Ross, Ommatophoca rossii Esta especie es la más escasa de las focas pagófilas. Su cuerpo es ...
http://www.ccamlr.org/pu/E/pubs/am/p2.htm

[an error occurred while processing this directive] Ommatophoca rossii [an error occurred while processing this directive] 15269
Ross Seal Ross Seal

Home | Search | About


Copyright SpeciesList.com 2003-2009