|
Osgoodomys banderanus - Michoacan Deer MouseIUCN Status: Lower Risk/Least ConcernIUCN Species Profile http://parasite.vetmed.ufl.edu/html/est/Pb/031/031PbF05.html National Center for Biotechnology Information (NCBI) welcome to ...: 308 LP + ++DEINNP LT+KT+ Sbjct: 78 LPSLRILYMMDEINNPALTVKTM 100 gi|755290 (U18836) cytochrome c oxidase II [Osgoodomys banderanus] >gi|1480774 (U62572 ... http://www.bioone.org/bioone/?request=get-document&issn=0076-3519&volume=704&issue=01&page=0001 <GENSP>Xenomys nelsoni</GENSP>: ...rodents primarily by its size and by a white spot over each eye and behind each ear; Baiomys musculus, Oryzomys, Osgoodomys banderanus, Nyctomys sumichrasti ... http://www.bioone.org/bioone/?request=get-document&issn=0076-3519&volume=725&issue=01&page=0001 <GENSP>Marmosa canescens</GENSP>: ...including Baiomys taylori, Hodomys alleni, Liomys pictus, Megasorex gigas, Neotoma mexicana, Oryzomys palustris, Osgoodomys banderanus, Peromyscus perfulvus ... http://www.fmnh.helsinki.fi/users/haaramo/Metazoa/Deuterostoma/Chordata/Synapsida/Eutheria/Rodentia/Myomorpha/Peromyscini.htm Criceridae: Sigmodontinae: Peromyscini: ...| |-- H. chinanteco ()? | | H. lophurus (harjashäntähiiri) | `-- H. lepturus ()? `- Osgoodomys banderanus [sgen. => Peromyscus?] ()? Reference(s): ... http://www.worldwildlife.org/wildworld/profiles/terrestrial/nt/nt0217_full.html Terrestrial Ecoregions -- Jalisco dry forests (NT0217): ...including Merriam’s desert shrew (Megasorex gigas), trumpet-nosed bat (Musonycteris harrisoni), Michoacan deer mouse (Osgoodomys banderanus), Chamela rat ... http://www.birdlist.org/biodiversity/mammals/allmammals/mammallist5.htm Mammallist5: RODENTIA, Muridae, Oryzomys, yunganus, Thomas, 1902. RODENTIA, Muridae, Osgoodomys, banderanus, (JA Allen, 1897). RODENTIA, Muridae, Otonyctomys, hatti, Anthony, 1932. ... http://genoma.unsam.edu.ar/projects/tupaia/blast_dir/nr/tu.fasta.screen.Contig246.br BLASTX 2.1.3 [Apr-1-2001] Reference: Altschul, Stephen F., Thomas ...: P Sbjct: 102 HQWYWSYEYTDYEDLCFDSYMIPTSDLKPGELRLLEVDNRVVLPMELP 149 >gi|755290|gb|AAA75617.1| (U18836) cytochrome c oxidase II [Osgoodomys banderanus] gb|AAB05788 ... http://www.nih.go.jp/yoken/genebank/MNCb/seq5/MNCb-1077.BLA BLASTN 2.0a2MP-WashU [20-Oct-1996] [Build 22:58:53 Oct 20 1996] ...: 1308 2.6e-53 1 gb|U83826|ROD NLU83826 Neotoma lepida NADH dehydrogena... 1298 7.9e-53 1 gb|U83860|ROD OBU83860 Osgoodomys banderanus NADH dehy... ... http://www.nih.go.jp/yoken/genebank/MNCb/seq5/MNCb-4135.BLA BLASTN 2.0a2MP-WashU [20-Oct-1996] [Build 22:58:53 Oct 20 1996] ...: 1254 9.8e-51 1 gb|U83827|ROD NFU83827 Neotoma floridana NADH dehydrog... 1251 1.3e-50 1 gb|U83860|ROD OBU83860 Osgoodomys banderanus NADH dehy... ... http://cueyatl.uam.mx/~posgrcbs/doctt.htm TESIS TERMINADAS: ...- ... 11-02-00, Arturo Núñez Garduño, Variación morfométrica y cariotÃpica y los ácaros parásitos de Osgoodomys banderanus (Rodentia: Muridae) e implicaciones ... http://bios.biologia.umich.mx/biologicas/refe.html Referencias Bibliograficas: ...- ... Núñez, GA, F. Cervantes R. y R. López W. 1999. Chromosomal variation of Osgoodomys banderanus (Rodentia: Muridae). Cytologia (64): 319-326. Tokyo, Japón. ... http://www.edomexico.gob.mx/se/especies1.htm FAUNA: ...- ... 95) RATON DE CAMPO, Oryzomys couesi fulgens Thomas, 1893 AM T*. 96) RATON DE CAMPO, Osgoodomys banderanus vicinor (Osgood, 1904) END. ... http://www.edomexico.gob.mx/se/BIO_INTERNET/monografia_c.html MONOGRAFIA EN EL ESTADO DE MÉXICO: ...- ... 95) RATON DE CAMPO Oryzomys couesi fulgens Thomas, 1893 AM T. 96) RATON DE CAMPO Osgoodomys banderanus vivinor (Osgood, 1904) END. ... http://geta.life.uiuc.edu/RDP/data/SubUnal/Unal_alpha.O.html SSU Unaligned rRNA Alphabetic List -- "O": None·····OBU67295·····Mitochondrion Osgoodomys banderanus None·····None ... http://www.ibiologia.unam.mx/cnma/nativos.html MAMIFEROS TERRESTRES NATIVOS DE MEXICO: ...- ... 1897 *. 322.- Oryzomys rostratus Merriam, 1901. 323.- Osgoodomys banderanus (JA Allen, 1897) **. 324.- Otonyctomys hatti Anthony, 1932. ... http://www.ibiologia.unam.mx/cnma/lista.html LISTA TAXONOMICA DE LOS MAMIFEROS TERRESTRES DE MEXICO: ...- ... 1901 Oryzomys saturatior Merriam, 1901 Oryzomys saturatior hylocetes Merriam, 1901 Oryzomys saturatior saturatior Merriam, 1901 Osgoodomys banderanus (JA Allen ... http://www.savci.upol.cz/hlod-4.htm Rodentia - Hlodavci: Yungas Rice Rat. Osgoodomys banderanus (JA Allen, 1897) - kÅ™eÄ?ek - Michoacan Deer Mouse: (syn. Peromyscus banderanus) Otonyctomys ... http://www.psb.ugent.be/rRNA/ssu/list/Mitochondria.html ssu rRNA Mitochondria: Orycteropus afer U97338; Mit. Orycteropus afer Y18475; Mit. Osgoodomys banderanus U67295; Mit. Osornophryne guacamayo U52744; Mit. Otus mindorensis U83753; Mit. ... http://www.genomics.purdue.edu/~jxu/Fgr/NCT3T7P/blast/1627_H12_P23ZT5.blastx.html NCBI BLAST Search Results: RR + R Sbjct: 297 KPRGRRPKPERPPSTSSSDSDSDSGEVDRISEWKRRDEERRRELEARRR 345 >gb|AAA75617.1| (U18836) cytochrome c oxidase II [Osgoodomys banderanus] gb|AAB05788.1 ... http://www.infobiogen.fr/db/embl-align/ALIGN_000001.dat ID ALIGN_000001; DNA; 886 symbols (36 sequences) XX AC ...: AF038018 Cynocephalus variegatus SO 15 Mus V00711 Mus musculus SO 16 Rattus V00680 Rattus norvegicus SO 17 Osgoodomys U67295 Osgoodomys banderanus SO 18 ... http://www.infobiogen.fr/db/cutg/CUTG/gbrod.spsum Abrothrix jelskii: 1 0 2 1 0 1 0 1 1 4 2 1 1 1 7 0 4 6 0 1 5 0 2 2 ...: 8 0 10 8 0 6 4 0 5 2 0 6 2 0 7 3 5 0 1 4 4 0 7 0 4 1 1 6 2 0 1 3 0 5 5 4 1 2 0 7 1 3 1 2 6 4 1 6 9 12 8 13 4 0 2 0 4 mitochondrion Osgoodomys banderanus: 2 1 1 ... http://www.esi.umontreal.ca/~bourdeav/HH/DB_HH/HTML/HH-II-3/HH-II-3.rod.sol.filN.html HH-I-3: 80 nuc ..|GU|C|AAG|CAAACACCAACACUUUCACACUUGUGCCCA|UUU|CUGACGA|GUU| --- OBU18836 Osgoodomys banderanus cytochrome c oxidase II gene, mitochondrial --- (684 bases ... http://www.genetics.org/cgi/content/full/150/1/345 Genetics -- Casavant et al. 150 (1): 345: ...and eremicus. A species from a closely related genus, Osgoodomys banderanus, was included in one aspect of this study. The taxonomic ... http://www.micro-genomes.mpg.de/cgi-bin/getblast.cgi?pir030305.orfprot.RB4417.blastp getblast.pl beck@molgen-mpg.de: ...cytochrome c oxi... 77 5e-13 SP_TREMBL:Q37754 Q37754 osgoodomys banderanus (michoacan deer mo... 77 5e-13 SP_TREMBL:Q9GBR0 Q9gbr0 nasutitermes nigriceps. ... http://perso.club-internet.fr/boudetjo/ZooList/Mammif/ClasRode.html Classification des Rodentiens: Oryzomys saturatior Oryzomys seuanezi Oryzomys subflavus Oryzomys talamancae Oryzomys xantheolus Oryzomys yunganus Osgoodomys banderanus Otonyctomys hatti ... http://nema.cap.ed.ac.uk/nematodeESTs/Ascaris/Ascaris300-324/Asmc-319xnr.html National Center for Biotechnology Information (NCBI) welcome to ...: LE+ L F++W Sbjct: 169 GLKTDAIPGRLNQATVTSNRPGVFYGQCSEICGSNHSFMPIVLEMIPLKFFENW 222 gi|755290 (U18836) cytochrome c oxidase II [Osgoodomys banderanus] >gi|1480774 ... http://industry.ebi.ac.uk/~alan/BioWidget/Taxonomy/tax4.data 1 root 1 2759 Eukaryotae 1 42452 unclassified eukaryotes 2759 ...: 38679 Onychomys arenicola 38667 38668 Onychomys leucogaster 38667 38674 Onychomys torridus 38667 37439 Osgoodomys 40141 37440 Osgoodomys banderanus 37439 37024 ... http://lgsun.grc.nia.nih.gov/cgi-bin/pro21?sname=L0906H10-5 Top Hits of L0906H10-5: J01435.1, 165.00, Blast. 16, Osgoodomys banderanus NADH dehydrogenase subunit 3 (ND3) gene,, U83860.1, 220.00, Blast. 17, Ondatra zibethicus ... http://bioinfo.hku.hk/db/cutg/gbrod.spsum Acomys cahirinus: 2 1 12 8 4 1 4 2 7 11 3 1 6 3 12 2 3 13 2 5 16 2 ...: 8 0 10 8 0 6 4 0 5 2 0 6 2 0 7 3 5 0 1 4 4 0 7 0 4 1 1 6 2 0 1 3 0 5 5 4 1 2 0 7 1 3 1 2 6 4 1 6 9 12 8 13 4 0 2 0 4 Mitochondrion Osgoodomys banderanus: 2 1 1 ... http://www.natureserve.org/infonatura/speciesIndex/Family_Muridae_147_6.htm [an error occurred while processing this directive] Osgoodomys banderanus [an error occurred while processing this directive] 15629 Michoacan Deer Mouse Michoacan Deer Mouse Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |