|
Parotomys brantsii - Brants's Whistling RatIUCN Status: Lower Risk/Least ConcernIUCN Species Profile http://www.ru.ac.za/academic/departments/zooento/Martin/pulicidae.html Checklist: South African Pulicid Fleas (Siphonaptera: Pulicidae): ...hosted by Tatera brantsii , T. leucogaster , Ictonyx striatus, Lepus capensis, Desmodillus auricularis , Gerbillurus paeba , Parotomys brantsii , Xerus inauris ... http://www.sun.ac.za/zoology/cherry/ Dr Michael Cherry: 2002. Differences in alarm vocalizations of sympatric populations of the whistling rats, Parotomys brantsii and P. littledalei. J. Zoology, Lond. 257: 189-194. ... http://web.uct.ac.za/depts/zoology/docs/publicat.html Publications: Jackson, TP 2000. Female nesting behaviour, pup growth and ontogeny in Brants' whistling rat (Parotomys brantsii). Journal of Zoology London 251: 417-425. ... http://web.uct.ac.za/org/rssa/transact/vol53-2.htm RSSA Transactions Vol 53 No. 2 (1998) The Kalahari Colloquium ...: 11. The Diurnal Activity of Brants' Whistling Rat (Parotomys brantsii): the Effect of Seasonal and Physical Conditions, by TP Jackson (Department of Zoology ... http://www.up.ac.za/academic/zoology/2003/publications.html Student Help: Alternative refuge strategies and their relation to thermophysiology in two sympatric rodents, Parotomys brantsii and Otomys unisulcatus. ... http://www.up.ac.za/services/research/report2001/2002/Faculties/Natural/DIER/Researcher/1429.htm Bennett NC: Roper TJ, Jackson TP, Conradt L, Bennett NC: 2002. Burrow use and the influence of ectoparasites in Brants' whistling rat, Parotomys brantsii. ... http://www.bavarianbirds.de/za/list.htm Birding South Africa November 2001: Brants's Whisling Rat (Parotomys brantsii) Brants' Pfeifratte, Some of the bigger rodents in the Kgalagadi Transfrontier Park belong probably to this species. ... http://animaldiversity.ummz.umich.edu/site/accounts/classification/Otomyinae.html ADW: Otomyinae: Classification: Species Otomys unisulcatus (bush vlei rat). Genus Parotomys (whistling rats). Species Parotomys brantsii (Brants's whistling rat). ... http://www.nfi.org.za/mammals/species%20list.html Transvaal Museum - Mammal Department: PETROMURIDAE (Dassie rat), Petromus, typicus, Dassie rat. MURIDAE (Rats & Mice), Parotomys, brantsii, Brants' whistling rat. littledalei, Littledale's whistling rat. ... http://www.microcomputerpower.com/ccabib/dd.html Annotated Bibliography of Canonical Correspondence Analysis and ...: 95 Du Plessis, A. & Kerley, GIH (1991) Refuge strategies and habitat segregation in two sympatric rodents Otomys unisulcatus and Parotomys brantsii. ... http://www.nigeldennis.com/subject.htm Nigel Dennis Wildlife Photography: ...pennatus Bottle Tree, Pachypodium lealii Bottlenosed Dolphin, Tursiops aduncus Bracket Fungus, Brant's Whistling Rat, Parotomys brantsii Bromeliad, Neoregalia ... http://www.monteco-nature-reserve.com/mammhead.htm MontEco Nature Reserve - Mammal List: D&N, S134, Porcupine, Hystrix africaeaustralis, Ystervark, N, S150, Brants' whistling rat, Parotomys brantsii, Brants se fluitrot, E, D, S156, ... http://www.monteco-nature-reserve.com/promero1.htm MontEco Nature Reserve - Barn Owl Diet - Promerops: January 1999 were: 1) A predominance of Brant's Whistling Rats Parotomys brantsii. 2) Striped Field Mice Rhabdomys pumilio. 3) Two ... http://www.visitsouthafrica.com/National_Parks/Richtersveld_np.asp VisitSouthAfrica.com - National Parks - Richtersveld National Park: Malcothrix typica. LARGE-EARED MOUSE. Otomys unisulcatus. BUSH KAROO RAT. Parotomys brantsii. BRANT'S WHISTLING RAT. Parotomys littledalei. LITTLEDALE'S WHISTLING RAT. ... http://www.worldwildlife.org/wildworld/profiles/terrestrial/at/at1309_full.html Terrestrial Ecoregions -- Kalahari xeric savanna (AT1309): ...endemic reptile (Typhlosaurus gariepensis) with nine near-endemic reptiles, and a single near-endemic small mammal, Brants's whistling rat (Parotomys brantsii ... http://www.worldwildlife.org/wildworld/profiles/terrestrial/at/at1314_full.html Terrestrial Ecoregions -- Nama Karoo (AT1314): Orycteropus afer) and steenbok (Raphicerus campestris) often use them as dung middens; Brant’s whistling rats (Parotomys brantsii) frequently colonize them ... http://www.savci.upol.cz/hlod-4.htm Rodentia - Hlodavci: Parotomys brantsii (A. Smith, 1834) - myš hvízdavá - Brants's Whistling Rat Parotomys littledalei Thomas, 1918 - myš Littledaleova - Littledale's Whistling ... http://zoo.upe.ac.za/teru/Publications.HTM Teru Publication List: 9. DU PLESSIS, A., KERLEY, GIH, & WINTER, PED 1993. Refuge microclimate of rodents: a surface nesting Otomys unisulcatus and a burrowing Parotomys brantsii. ... http://www.ingenta.com/isis/searching/ExpandTOC/ingenta?issue=pubinfobike://nisc/ostrich/2004/00000075/f0020001&index=8 Ingenta: Article Summary -- The relative influence of prey ...: ...performance of each group was strongly linked to the abundance of the dominant, otomyine rodent prey (Otomys unisulcatus and Parotomys brantsii) and it was ... http://www.ingenta.com/isis/browsing/TOC/ingenta?issue=pubinfobike://ap/ae/2002/00000051/00000001 Ingenta: Table of Contents -- Journal of Arid Environments, May ...: 2. Alternative refuge strategies and their relation to thermophysiology in two sympatric rodents, Parotomys brantsii and Otomys unisulcatus Jackso TP; Roper TJ ... http://www.baslerafrika.ch/UPDATE2000.html UPDATE2000: CG.Coetzee & TP.Jackson The comparative behaviour and ecology of Parotomys brantsii and P.littledalei (Mammalia, Rodentia, Otombyinae) In: Journal Namibia ... http://www.sussex.ac.uk/biology/profile2284.html Profile: Prof Timothy Roper: Jackson, MJ, Bennett, NC (2002) Alternative refuge strategies and their relation to thermophysiology in two sympatric rodents, Parotomys brantsii and Otomys ... http://www.routes.co.za/nature/ecoregions/kalaharidesert.html Routes Travel Info Portal: Kalahari desert - Kalahari xeric ...: ...cucumbers (Cucumis africanus). TOP. Mammals. There are few endemic species. near-endemic small mammal: Brants's whistling rat (Parotomys brantsii); large predators: ... http://www.routes.co.za/nature/ecoregions/karoo.html Routes Travel Info Portal: Karoo on West Coast - Succulent Karoo ...: ...granti); Brant’s whistling rat (Parotomys brantsii). TOP. Birds. The region has 226 species of birds with 5 endemic species. Endemic ... http://www.fas.umontreal.ca/BIOL/Casgrain/cca_bib_93/methods/detrended_canonical_corre.html CCA Bib 93, DCCA: 95. Du Plessis, A. & Kerley, GIH (1991) Refuge strategies and habitat segregation in two sympatric rodents Otomys unisulcatus and Parotomys brantsii. ... http://www.fas.umontreal.ca/BIOL/Casgrain/cca_bib_93/organisms/rodents.html CCA Bib 93, Rodents: Rodents. 95. Du Plessis, A. & Kerley, GIH (1991) Refuge strategies and habitat segregation in two sympatric rodents Otomys unisulcatus and Parotomys brantsii. ... http://www.houthoop.co.za/aPhoto.shtml Animal Photo Gallery: Cape Serotine Bat - Eptesicus capensis; Brants Whistling Rat - Parotomys brantsii. Striped Mouse - Rhabdomys pumilo; Porcupine - Hystrix africaeaustralis. Site Map, ... http://www.vsppub.com/jconts/BEHA/jc-Vol138No6pp691796200.html Volume 138, No. 6, pp. 691--796, 2001: Does Brants' whistling rat (Parotomys brantsii) use an urgency-based alarm system in reaction to aerial and terrestrial predators? ... http://www.vsppub.com/jconts/BEHA/jc-Vol138No10pp120131200.html Volume 138, No. 10, pp. 1205--1318, 2001: The effect of changing call duration and calling bouts on vigilance in Brant's whistling rat, Parotomys brantsii Le Roux, A., Jackson, TP & Cherry, MI 1287. ... http://peter.maxitec.co.za/capebirdingroute/Namaqualand_Diamond_Coast.htm CapeBirdingRoute: Also keep a look out for Brants’s Whistling Rat (Parotomys brantsii), which is quite common here as well as in sandy areas throughout Namaqualand. ... http://nema.cap.ed.ac.uk/nematodeESTs/Trichinella/Trichinella_B1/Tstable300-349/Tsmc_335nnr.html BLASTN 2.1.1 [Aug-8-2000] Reference: 68 5e-09 gb|AF141256.1|AF141256 Parotomys littledalei country Namibi... 68 5e-09 gb|AF141255.1|AF141255 Parotomys brantsii 16S ribosomal RNA... ... http://nema.cap.ed.ac.uk/nematodeESTs/Trichinella/Trichinella_B1/Tstable300-349/Tsmc_338nnr.html BLASTN 2.1.1 [Aug-8-2000] Reference: 42 0.21 gb|AF141256.1|AF141256 Parotomys littledalei country Namibi... 42 0.21 gb|AF141255.1|AF141255 Parotomys brantsii 16S ribosomal RNA... ... http://146.230.130.48/conspec/Refs1.htm Refs1: Rookmaaker, LC and Meester, J. Euryotis brantsii A.Smith, 1834 (currently Parotomys brantsii; Mammalia, Cricetidae): proposed conservation of specific name. ... http://146.230.130.48/conspec/bank.htm CONSPEC Bank: 146.230.130.48/conspec/bank.htm - 4k - Supplemental Result - Cached - Similar pages AJOL: South African Journal of Wildlife Research: Volume 31, Issue ... ... unisulcatus. Densities of heuweltjies (raised soil mounds) accounted for 56% of the variation in the density of Parotomys brantsii warrens. ... http://www.inasp.info/ajol/journals/sajwr/vol31no1-2abs.html AJOL: South African Journal of Wildlife Research: Volume 31, Issue ...: ...unisulcatus. Densities of heuweltjies (raised soil mounds) accounted for 56% of the variation in the density of Parotomys brantsii warrens. ... http://www.birdtours.co.uk/tripreports/s_africa/tour10/mammal%20list.htm Mammals, Bushmanland and the Kalahari Gemsbok, February 2004: Brant’s Whistling Rat Parotomys brantsii 1 near Twee Rivieren 15/2, 1 near Mata Mata 19/2. Bateared Fox Otocyon megalotis 2 north of Nossob on night drive. ... http://www.blackwell-synergy.com/links/doi/10.1111/j.0906-7590.2003.03584.x/enhancedabs/ The influence of behaviour and season on habitat selection by a ...: ..., Jackson, TP. 2001. Factors influencing food collection behaviour of Brants' whistling rat (Parotomys brantsii): a central place forager. -J. Zool. ... http://www.rodent.be/rodentnederlands/Taxonomie/muridae.htm Muridae: Otomys typus. Otomys unisulcatus. Otomys occidentalis. Parotomys. Parotomys brantsii. Parotomys littledalei. Subfamilie Arvicolinae. Alticola. Alticola albicauda. ... http://www.rodent.be/rodentfrans/Taxonomie/muridae.htm Muridae: Otomys unisulcatus. Otomys occidentalis. Parotomys. Parotomys brantsii. Parotomys littledalei. Genre Arvicolinae. Alticola. Alticola albicauda. Alticola argentatus. ... http://wingsbirds.com/birdlists/safraug03.htm WINGS Birding Tours... Western South Africa 2003 Birdlist: Cape Rhebok, 1, 2, Raphicerus melanotis. Cape Ground-squirrel, 4, 100, Xerus inauris. Brandt's Whistling Rat, 1, 6, Parotomys brantsii. Striped Mouse, 2, 2, Rhabdomys pumilio. ... http://perso.club-internet.fr/boudetjo/ZooList/Mammif/ClasRode.html Classification des Rodentiens: ...maximus Otomys occidentalis Otomys saundersiae Otomys sloggetti Otomys tropicalis Otomys typus Otomys unisulcatus Parotomys brantsii Parotomys littledalei. ... http://genoma.unsam.edu.ar/projects/tupaia/blast_dir/nr/tu.fasta.screen.Contig226.br BLASTX 2.1.3 [Apr-1-2001] Reference: Altschul, Stephen F., Thomas ...: Sbjct: 181 FHFILPFIITALVVVHLLFLHETGSNNPIGLDSNADKIPFHPYYTIKDI 229 >gi|7648617|gb|AAF65613.1| (AF141224) cytochrome b [Parotomys brantsii] Length = 380 Score ... http://www.sofnet.org/index.asp?lev=1248&typ=1 Sveriges Ornitologiska förening:Sydafrika 18 oktober - 10november ...: Lucia 1/11 Blå markatta Cercopithecus mitis 3 ex Oribi Gorge NR 29/10 Brants´s Whistling Rat Parotomys brantsii 1 ex Karoo 8/11 Sloggett´s Rat Otomys ... http://www.und.ac.za/und/cogen/bank.html CONSPEC Bank: ...www.und.ac.za/und/cogen/bank.html - 4k - Cached - Similar pages Richtersveld National Park ... Malcothrix typica, LARGE-EARED MOUSE. Otomys unisulcatus, BUSH KAROO RAT. Parotomys brantsii, BRANT'S WHISTLING RAT. Parotomys littledalei, LITTLEDALE'S WHISTLING RAT. ... http://www.parks-sa.co.za/parks/Richtersveld/default.html Richtersveld National Park: Malcothrix typica, LARGE-EARED MOUSE. Otomys unisulcatus, BUSH KAROO RAT. Parotomys brantsii, BRANT'S WHISTLING RAT. Parotomys littledalei, LITTLEDALE'S WHISTLING RAT. ... http://www.esapubs.org/archive/ecol/E084/094/MOMv3.3.txt AF extant Artiodactyla Bovidae Addax nasomaculatus 4.85 70000.3 60 ...: ...- ... Otomys sloggetti 2.03 106.3 "113, 129" AF extant Rodentia Muridae Pachyuromys duprasi 1.68 47.5 70 AF extant Rodentia Muridae Parotomys brantsii 2.11 129.5 60 ... http://ecol.zool.kyoto-u.ac.jp/homepage/serow/references.html references.html: JUL 01 1991 v 22 n 3 287. Refuge strategies and habitat segregation in two sympatric rodents Otomys unisulcatus and Parotomys brantsii. ... http://www.phthiraptera.org/Mammals/Muridae.html Mammals: Muridae: Polyplax otomydis Cummings, 1912. Parotomys - Whistling Rats. Parotomys brantsii (A. Smith, 1834) - Brant´s Whistling Rat Polyplax myotomydis Johnson, 1960. ... http://scilib.univ.kiev.ua/volume.php?126428 Сервер періодичних видань::Каталог ...: TP JACKSON, SEASONAL-VARIATION IN THE DIET AND FORAGING BEHAVIOR OF BRANTS WHISTLING RAT, PAROTOMYS BRANTSII, IN NORTHERN NAMAQUALAND, 00037-00041. ... http://www.surfbirds.com/mb/trips/kalahari-nr-0504-sp.html Bird watching trip report - Bushmanland and the Kalahari Gemsbok ...: Striped Mouse Rhabdomys pumilio 2 Olifants Bay, Cape NR, 2 Bontebok NR 23/2. Brant's Whistling Rat Parotomys brantsii 1 near Twee Rivieren 15/2, 1 near Mata ... http://www.research.up.ac.za/2001/UP_Research_Report/Faculties/Natural/Biological/DIER/Output/articles.htm [an error occurred while processing this directive] Parotomys brantsii [an error occurred while processing this directive] 16270 Brants's Whistling Rat Brants's Whistling Rat Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |