|
|
Pelea capreolus - Common Rhebok, Grey RhebokIUCN Status: Least ConcernIUCN Species Profile http://www.itis.usda.gov/servlet/SingleRpt/SingleRpt?search_topic=TSN&search_value=624990 ITIS Standard Report Page: Pelea: Subfamily, Peleinae Gray, 1872, Genus, Pelea Gray, 1851, Direct Children: Species, Pelea capreolus (Forster, 1790) -- common rhebok, References, Expert(s): ... http://www.ecotravel.co.za/Guides/Wildlife/Vertebrates/Mammals/Large/Grey_Rhebok.htm The Grey Rhebok - Pelea capreolus of Southern Africa: A Guide to the: Grey Rhebok - Pelea capreolus. Grey Rhebok are slender, graceful antelope with long, slender necks, and very long, pointed ears. ... http://www.ultimateungulate.com/Artiodactyla/Pelea_capreolus.html Vaal rhebuck, Gray rhebok: Pelea capreolus. Vaal rhebuck, Gray rhebok. Taxonomy Pelea capreolus [Forster, 1790]. Citation: In Levaillant, Erste Reise Afrika, p. 71. ... http://www.ultimateungulate.com/Artiodactyla.html Artiodactyla: African oryx Oryx dammah Scimitar-horned oryx Oryx gazella Gemsbok, South African oryx Oryx leucoryx Arabian oryx Peleinae Pelea Pelea capreolus Vaal rhebuck ... http://fernkloof.com/species.mv?1210 Pelea capreolus - Grey rhebok. Vaalribbok - Mammals in Fernkloof ...: Pelea capreolus. ... Fernkloof Nature Reserve. Pelea capreolus. Common name - Grey rhebok. Vaalribbok. Click on the photo for a better picture Pelea capreolus. ... http://fernkloof.com/animals.mv Fernkloof Nature Reserve - Animals and mammals.: Animals of Fernkloof Nature Reserve. ... http://www.jww.de/artikelbeitrag/artikelbeitrag_13448.html JAGEN WELTWEIT: Rhebock <i>Pelea capreolus</i> (Forster, 1790): ...- Praxistipps, - Trense. Rhebock Pelea capreolus (Forster, 1790). English: Grey Rhebok; French: Rhebuck; Afrikaans: Vaal Riebok; Sotho ... http://www.jww.de/artikelbeitrag/artikelbeitrag_13623.html JAGEN WELTWEIT: Das große Wildarten-Lexikon von Trense: ...- ... Rappenantilope Hippotragus niger (Harris, 1838) Rehwild Capreolus capreolus (Linné, 1758) Rhebock Pelea capreolus (Forster, 1790) Riesen-Elenantilope ... http://www.funet.fi/pub/sci/bio/life/mammalia/artiodactyla/bovidae/pelea/ Pelea: See [About maps]. Pelea capreolus (Forster, 1790) capreolus (Forster, 1790); in Levaillant, Erste Reise Afrika: 71, TL: Cape of Good Hope 28.10.2001 (1). ... http://timeweb.wisdomtools.com/dbt/site34867.html Die Kelders Cave: Panthera leo, Panthera leo, Papio ursinus, Papio ursinus, Pelea capreolus, Pelea capreolus, Pelea capreolus, Pelea capreolus, Pelea capreolus, Pelea capreolus, ... http://timeweb.wisdomtools.com/dbt/object34867,12,17.html Pelea capreolus: Objects | Archaeology Index Pelea capreolus. Description, vaalribbok; MNI=1. Site, Die Kelders Cave. Assemblage, Layer 14 fauna. Date Measurements: ... http://212.187.155.84/wnv/Subdirectories_for_Search/SpeciesKingdoms/0Families_ACrM_Artiodactyla/Bovidae/Pelea/Pelea_capreolus/Pelea_capreolus.html Pelea capreolus - Grey rhebok (Species Link Page): SPECIES LINK PAGE. Pelea capreolus - Grey rhebok: Summary Information. Living Organisms / Animalia / Craniata / Mammalia / Artiodactyla ... http://www.bioone.org/bioone/?request=get-abstract&issn=0022-3395&volume=087&issue=05&page=1095 <IT>HAEMONCHUS HORAKI</IT> N. SP. (NEMATODA: TRICHOSTRONGYLOIDEA) ...: 87, No. 5, pp. 1095–1103. HAEMONCHUS HORAKI N. SP. (NEMATODA: TRICHOSTRONGYLOIDEA) FROM THE GREY RHEBUCK PELEA CAPREOLUS IN SOUTH AFRICA. ... http://www.bioone.org/bioone/?request=get-citation-links&doi=10.1043/0030-2465(1992)059%3C0179:POSAWX%3E2.0.CO;2&id=I0022-3395-087-05-1095-BOOMKER1&sitename=BIOONE Citation Links: XIII. Helminths of grey rhebuck, Pelea capreolus, and of bontebok, Damaliscus dorcas dorcas, in the Bontebok National Park Onderstepoort Journal of Veterinary ... http://www.floranimal.ru/pages/animal/p/368.html ПЕЛЕÐ?: ПЕЛЕÐ? (Pelea capreolus). Млекопитающие / Парнокопытные / Полорогие / ПЕЛЕÐ? Mammalia ... http://www.floranimal.ru/intredbook_.php?Artiodactyla МеждународнаÑ? КраÑ?наÑ? Книга ...: Ourebia ourebia); ОРИКС (Oryx gazella); ОРОÐ?ГО (Pantholops hodgsoni); ПЕЛЕÐ? (Pelea capreolus); ПУКУ (Kobus vardoni ... http://www.press.jhu.edu/books/walkers_mammals_of_the_world/artiodactyla/images/image.mid.artiodactyla.bovidae.pelea.capreolus.1.html Image Page, Artiodactyla Bovidae Pelea: Artiodactyla Bovidae Pelea. Rhebok (Pelea capreolus), photo by Herbert Lang through J. Meester. Return to Genus Copyright © 1997 ... http://www.press.jhu.edu/books/walkers_mammals_of_the_world/artiodactyla/images/image.artiodactyla.bovidae.pelea.html Thumbnails Page, Artiodactyla Bovidae Pelea: Artiodactyla Bovidae Pelea (Click on thumbnail to view larger image). Rhebok (Pelea capreolus), photo by Herbert Lang through J. Meester. ... http://www.interaktv.com/mammals/TubuliArt.html Biologybase: Mammals of the World: Tubulidentata through ...: Hippotragus niger. Oryx dammah. Oryx gazella. Oryx leucoryx. Peleinae, Pelea capreolus. Reduncinae, Kobus ellipsiprymnus. Kobus kob. Kobus leche. Kobus megaceros. ... http://www.parks-sa.co.za/conservation/scientific_services/ss_horakrhebok.html THE LONG TERM ABUNDANCE OF PARASITES OF GREY RHEBOK: The Long Term Abundance Of Parasites Of Grey Rhebok, Pelea Capreolus, Bontebok, Damaliscus Dorcas Dorcas, Scrub Hares, Lepus Saxatilis, And Rodents In The ... http://www.parks-sa.co.za/conservation/scientific_services/ss_contents98.html Leaders and Projects: HORAK, IG, THE LONG TERM ABUNDANCE OF PARASITES OF GREY RHEBOK PELEA CAPREOLUS, BONTEBOK DAMALISCUS DORCAS DORCAS, SCRUB HARES LEPUS SAXATILIS AND RODENTS IN ... http://www.highbeam.com/library/search.asp?FN=AO&refid=ency_refd&search_thesaurus=on&refid=ency_refd&q=rhebok HighBeam Research: eLibrary Search: Results: The rhebok ( Pelea capreolus ) resembles the reedbuck but has a woolly coat; it is found in hilly country in S Africa. Marsh antelopes ... 10. ... http://www.highbeam.com/library/search.asp?FN=AO&refid=ency_refd&search_dictionaries=on&refid=ency_refd&q=rhebok HighBeam Research: eLibrary Search: Results: 1. rhebok Webster's NewWorld Dictionary; January 1, 1988 rhe|bok (re'bk) n. a rare South African antelope (Pelea capreolus) with woolly, brownish-gray hair ... http://www.chez.com/monamiph/afsud94.htm Liste naturaliste afrique du sud 1994: ...- ... Pietersburg,. Reduncines: Kobus ellipsiprysmnus Ogilby Cobe à croissant Krüger; Pelea capreolus Forster Rhebuck Giant castle, Golden gate; ... http://www.up.ac.za/academic/veterinary/depts_wild_projects.htm Departments - Wildlife Unit - Projects: Productivity of mountain reedbuck (Redunca fulvorufula) and grey rhebok (Pelea capreolus) in marginal habitat: A contribution to community upliftment. ... http://www.up.ac.za/academic/veterinary/depts_wild_pers.htm Departments - Wildlife Unit - Personnel: Productivity of mountain reedbuck (Redunca fulvorufula) and grey rhebok (Pelea capreolus) in marginal habitat: A contribution to community upliftment; ... http://perso.club-internet.fr/boudetjo/ZooList/Mammif/ClasArti.html Classification des Artiodactyles: ...- ... niger Oryx dammah Oryx gazella Oryx leucoryx. PELEINAE, Pelea, Pelea capreolus. REDUNCINAE, Kobus Redunca, Kobus ellipsiprymnus Kobus kob ... http://www.gisbau.uniroma1.it/amd/amd213b.html ARTIODACTYLA: Bovidae. Pelea capreolus. ... Habitat selection and ecological separation between the grey rhebuck (Pelea capreolus) and the klipsplinger (Oreotragus oreotragus). ... http://www.gisbau.uniroma1.it/amd/pelea.html species of Pelea: ...- ... Capra Cephalophus Sylvicapra Addax Hippotragus Oryx Pelea: Pelea capreolus. Kobus Redunca. Pholidota, Rodentia. Lagomorpha, Macroscelidae. http://robetta.bakerlab.org/taxonomy.jsp?id=909 Robetta Server Job 909 NR PSI-Blast Taxonomy Results: Sylvicapra grimmia]. 59552, Pelea capreolus, 1 (0.75%), 4E-35, 10-99, 1-90, 147, 96, 90, gb|AAK67753.1|, kappa-casein [Pelea capreolus]. 66444, ... http://robetta.bakerlab.org/taxonomy.jsp?id=910 Robetta Server Job 910 NR PSI-Blast Taxonomy Results: Alcelaphus buselaphus]. 59552, Pelea capreolus, 1 (0.72%), 2E-38, 10-99, 1-90, 159, 96, 90, gb|AAK67753.1|, kappa-casein [Pelea capreolus]. 59531, ... http://www.infochembio.ethz.ch/links/zool_saeuget_antilope.html Antilopen: Säugetiere: Coke's Hartebeest - Image. Common Rhebok (Pelea capreolus) (University of Michigan) - Text. Cuvier's Gazelle (Gazella cuvieri) - Text and Images. ... http://home.no.net/trohi/mammalia/artiodactyla/bovidae.html bovidae.html: Alcelaphini). RÃ¥dyrantilope (Pelea capreolus) er ogsÃ¥ utgÃ¥tt i egen underfamilie (Peleinae, tidligere i stammen Reduncini). Underfamilie, ... http://www.erhverv.toldskat.dk/obj.asp?o_id=152176&chk=200522 ToldSkat: Grysbok, Raphicerus melanotis/sharpei. Suni, Neotragus moschatus. Vaal Rhebok, Pelea capreolus. Waterchevrotain, Hyemoschus aquaticus. Black Buck, Antilope cervicapa. ... http://mitglied.lycos.de/fischenjagen/wild.htm Wild: ...- ... Riedbock (Redunca redunca); Bergriedbock (Redunca fulvorufula); Rehantilope (Pelea capreolus). U.fam: Gazellenartige (Antilopinae), Art: Gazelle. U.fam. ... http://www.wordreference.com/definition/reebok.htm Definition of reebok - WordReference.com Dictionary: English Dictionary © 2000 HarperCollins Publishers: rhebok, reebok ['riË?bÊŒk, -bÉ’k] noun (plural: -boks, -bok) an antelope, Pelea capreolus, of southern ... http://www.fact-index.com/g/gr/grazing_antelope.html Grazing antelope: Reedbuck, Redunca fulvorufula; Bohor Reedbuck, Redunca redunca; Gray Rhebok, Pelea capreolus; Waterbuck, Kobus ellipsiprymnus; Kob, Kobus ... http://usuarios.lycos.es/criptozoo/Clasificacion/Artiodactilos.html Clasificación de los artiodáctilos citados: ...- ... Bóvidos]: Rumiantes con cuernos huecos y persistentes. (Bueyes, antÃlopes, cabras, ovejas...): Pelea capreolus: AntÃlope del Vaal. ... http://www.phthiraptera.org/classification/trichodectidae/damalinia/damalinia.html Damalinia: ...__. ornata Werneck, 1957 Type host: __ __ __. pelea (Bedford, 1934) (Bovicola) Type host: Pelea capreolus (Bechstein). smitheileri ... http://www.encyclopedia.com/html/m1/marshant.asp marsh antelope on Encyclopedia.com: Africa. The rhebok ( Pelea capreolus ) resembles the reedbuck but has a woolly coat; it is found in hilly country in S Africa. Marsh ... http://72.1911encyclopedia.org/A/AN/ANTEMNAE.htm ANTEMNAE: ...ge In some respects connecting the last group with the Cervi- in prinae is the rhebok, or vaal-rhebok (Pelea capreolus), a grey srr telope of the size of a ... http://www.factmonster.com/ce6/sci/A0831966.html marsh antelope: Africa. The rhebok (Pelea capreolus) resembles the reedbuck but has a woolly coat; it is found in hilly country in S Africa. Marsh ... http://bnhm.berkeley.museum/browse/vertebrates_Mammalia_Artiodactyla_Bovidae_Pelea_all.php?ViewResults=vertebrates_Mammalia_Artiodactyla_Bovidae_Pelea_all Berkeley Natural History Museums: Browse Genus equals Pelea by Scientific Name for All Museums, Genus: Pelea view specimens Pelea capreolus (Unspecified) (1) view specimens. Google. ... http://www.naturalezaycaza.com/fichaanimal.php?animal=11 Naturaleza y Caza: animales del mundo: ...- ... copyright. Nombre en latÃn: Pelea capreolus Nombre en ingles: Vaal Rhebok Familia: Bóvidos Orden: Artiodáctilos Suborden: Rumiantes Altura: 70-75 cm. ... http://www.wildlifesafari.info/rhebuck_grey.html Grey Rhebok | African Animals | Rhebuck | Antelope | Wildlife ...: GREY RHEBOK - Pelea capreolus. SIZE: Shoulder height (m) 0,8 m, (f) 0,7 m; mass 20 kg. COLOUR: Grey-brown or grey above, but slightly ... http://www.malealea.co.ls/bushman_paintings.htm ABCDEFGHIJKLMONOPQRSTUVWXYZ: Tohlong 1 is notable for the many finely detailed depictions of rhebuck (Pelea capreolus); an animal important to Bushmen in that its social organisation - it ... http://www.faunistik.net/BSWT/MAMMALIA/UNGULATA/BOVIDAE/bovidae.html Mammalia: Bovidae - Rinderartige: ...- ... Riedbock - Redunca redunca. Bergriedbock - Redunca fulvorufula. Rehantilope - Pelea capreolus. Pferdeböcke - Hippotraginae. Pferdeantilope - Hippotragus equinus. ... http://www.masai-mara.com/mmscx.htm Order: Beisa Oryx (Gemsbok). Peleinae. Rheboks. Pelea capreolus. Rhebok (Grey Rhebok). Reduncinae. (Several). Kobus ellipsiprymnus ellipsiprymnus. Common Waterbuck. ... http://www.ultimatefieldguide.com/100Species.htm 100 Species: Mountain Reedbuck - Redunca fulvorufula. Grey Rheebuck- Pelea capreolus. Springbuck - Antidorcas marsupialis. Impala - Aepyceros melampus melampus. ... http://www.sabie.co.za/about/natural_heritage.html Natural Heritage - Sabie: The grassveld is the refuge of a number of small game species such as the oribi (Ourebia ourebia), grey rhebuck (Pelea capreolus) and red duiker (Cephalophus ... http://www.markuskappeler.ch/tex/texs/damagazelle2.html Damagazelle: ...- ... Die Palette reicht von der zierlichen, mit 20 bis 30 Kilogramm Körpergewicht kaum rehgrossen Rehantilope (Pelea capreolus) bis hin zur massigen, mit etwa 900 ... http://61.9.197.64/savuti/hunting_price.htm Pricelist: Giraffe, Giraffa camelopardalis, US$, 3,000.00, Grey rhebuck, Pelea capreolus, US$, on request, Ground squirrel, Xerus inauris, US$, on request, ... http://61.9.197.64/savuti/grey%20rhebuck.htm Grey Rhebuck: Grey Rhebuck (Pelea capreolus). Size, Weight, 40 – 50 lb (18 - 23kg). Shoulder height, 24 – 30’’ (61 - 76cm). Horns, Males only. ... http://www.sntc.org.sz/checklst/sdmamchk.html Swaziland National Trust Commission - Swaziland's Fauna: ...dorcus Damaliscus lunulatus Aepyceros melampus Oreortagus oreotragus Ourebia ourebi Raphicerus campestris Raphicerus sharpei Pelea capreolus, Bushpig Warthog ... http://www.monteco-nature-reserve.com/mammhead.htm MontEco Nature Reserve - Mammal List: S319, Cape grysbok, Raphicerus melanotis, Grysbok, E, D&N, S324, Grey rhebok, Pelea capreolus, Vaalribbok, E, D, S327, Gemsbok, Oryx gazella, Gemsbok, T, D&N, ... http://www.monteco-nature-reserve.com/mammalsb.htm MontEco Nature Reserve - Our Mammals: This habitat is ideal for the grey rhebok (order Artiodactyla, family Bovidae, subfamily Peleinae, species Pelea capreolus), another species independent of ... http://www.bavarianbirds.de/za/list.htm Birding South Africa November 2001: ...probably to this species. Grey Rhebok (Pelea capreolus) Rehantilope, 1 near Bredasdorp on 12.11. Blue Wildebeest (Connochaetes taurinus ... http://sneakers.pair.com/g-r.htm Charlie's Sneaker FAQ and Glossary - R: Reebok Reebok Classic Leather Mid sneaker (white, gray trim) A brand name for athletic shoes. Named for the southern African antelope (Pelea capreolus). ... http://www.overberginfo.com/sunbird_fynbos_bandb/animals.htm Animals spotted at Sunbird Fynbos Reserve in Napier South Africa: 5, Common duiker, Duiker, Sylvicapra grimmia. 6, Grey Rhebok, Vaalrebok, Pelea capreolus. 7, mouse, Muis, 8, Porcupine, Ystervark, Hystrix africaeaustralis. ... http://www.fmnh.helsinki.fi/users/haaramo/Metazoa/Deuterostoma/Chordata/Synapsida/Eutheria/Artiodactyla/Bovioidea/Bovidae.htm Bovidae: ...==o Bovidae (cows, sheeps, goats, antilopes and relatives; onttosarviset märehtijät) |?- Pelea capreolus [Peleini] (kaurisantilooppi) |--o Antilopinae ... http://www.tierseiten.com/paarhufer/paarhufersystematik.html Systematik der Paarhufer: ...- ... Unterfamilie: Reduncinae (Riedböcke) Gattungsgruppe: Peleini (Rehantilopen) Gattung: Pelea (Rehböckchen) Art: Pelea capreolus (Rehantilope) Gattungsgruppe ... http://www.bluewaterbiggame.com/game/vaal_rhebok.cfm Vaal Rhebok Hunting African Safaris and Rowland Ward SCI World ...: ...rowland ward and sci world record book score for vaal rhebok hunting african safaris - 05-31-2004. Vaal Rhebok. (Pelea capreolus). ... http://www.capehuntsafaris.co.za/ Cape Hunt Safari's - Trophy Hunting for the Discerning Hunter!: Bontebok- Domaliscus dorcas dorcas Reedbuck - Redunca arundinum Mountain Reedbuck - Redunca fulvorufula Grey Rheebuck- Pelea capreolus Springbuck - Antidorcas ... http://www.deer.rr.ualberta.ca/library/taxonomy/Artiodactyla.html Artiodactyla: ...fringe-eared oryx Oryx leucoryx - Arabian oryx. Peleinae. Pelea capreolus -. Reduncinae. Kobus ellipsiprymnus - Waterbuck Kobus kob - Kob ... http://www.icon.co.za/~webotha/prices.htm Prices: Swartneusrooibok. Aepyceros melampus petersi. On request. Grey rhebok. Vaalribbok. Pelea capreolus. 600. Roan antelope. Bastergemsbok. Hippotragus equinus. On request. ... http://apt.allenpress.com/aptonline/?request=get-toc&issn=0022-3395&volume=087&issue=05 Journal of Parasitology 87/5: 1094. [Abstract]. HAEMONCHUS HORAKI N. SP. (NEMATODA: TRICHOSTRONGYLOIDEA) FROM THE GREY RHEBUCK PELEA CAPREOLUS IN SOUTH AFRICA. J ... http://www.routes.co.za/nature/ecoregions/drakensberg.html Routes Travel Info Portal: Drakensberg lower regions - Drakensberg ...: ...reedbuck (Redunca fulvorufula); grey rhebok (Pelea capreolus); black wildebeest (Connochaetes gnou); oribi (Ourebia ourebi); endemic: ... http://www.nelsonmandelabaytours.com/mountainzebra.htm The Mountain Zebra National Park: Raphicerus campestris. Klipspringer. Oreotragus oreotragus. Grey rhebuck. Pelea capreolus. Cape Buffalo. Syncerus caffer. ORDER PERISSODACTYLA, Family Rhinocerotidae, ... http://www.wta.org.za/info/animals.htm Game Species: Reedbuck, Mountain, Rooiribbok, Redunca fulvorufula, Artiodactyla, Bovidae, Reduncinae. Rhebuck, Grey, Vaalribbok, Pelea capreolus, Artiodactyla, Bovidae, Peleinae. ... http://www.wetlands.org/RDB/Ramsar_Dir/SouthAfrica/ZA017D02.htm Ramsar Sites Database: ...the wetland-related Cape weaver Ploceus capensis), three endemic mammals (Poecilogale albinucha, Damaliscus dorcas phillipsi and Pelea capreolus) and an ... http://www.kwiktan.com/taxidermy.htm Taxidermy: Melanotis). Cape Bushbuck (Tragelaphus Scriptus), Mountain Reedbuck (Redunca Fulvorufula), Vall Rhebok (Pelea Capreolus). Mountain Reedbuck ... http://www.nasmus.co.za/MAMMALS%5CPUBLICAT.HTM publication: ...owl pellets. Avenant, NL Rhebok, Pelea capreolus. In: The mammals of Africa. Kingdon, J., Happold, D. & Butynski, T. (eds.). Avenant ... http://www.ccbirding.com/rz/africa/list.htm List of reptiles:: Hippotragus equinus Roan antilope. Hippotragus niger Sable antilope. Pelea capreolus Grey rhebok. Raphicerus campestris Steenbok. Namaqua dune mole. ... http://www.africatrophyhunting.com/TrophyRoom.asp?PageStack=%2FTrophies.asp%3Ff%3D4&Id=12 Africa Trophy Hunting :: Thormahlen and Cochran Classic African ...: Client: Vaal Rhebok. Species: Pelea Capreolus. Region: South-eastern RSA. Client: Gray Thornton. Species: Vaal Rhebok - 10 1/8. Region: Western Cape. ... http://www.kopana.co.za/template.asp?action=sub&subid=9&id=4 Kopana Game Retreat: Paraxerus cepapi, Tree squirrel, Boomeekhoring. Pelea capreolus, Mountain rheedbuck, Rooiribbok. Phacochoerus aethiopicus, Warthog, Vlakvark. ... http://www.fgsafaris.com/GerPrices.htm Price: ...- ... 600. NYALA (Tragelaphus angasii). 2200. REEDBUCK mountain (Redunca fulvorufula). 300. RHEBOK VALL (Pelea capreolus). 850. SPRINGBOK cape (Antidorcas marsupialis). 250. ... http://peter.maxitec.co.za/capebirdingroute/Overberg_Bontebok_NP.htm CapeBirdingRoute: Damaliscus dorcas dorcas: an antelope which once came precariously close to extinction but which is now flourishing), Grey Rhebok (Pelea capreolus) and Cape ... http://eo.wikipedia.org/wiki/Bovedoj Bovedoj - Vikipedio: ...[redaktu]. subfamilio : peleenoj - Peleinae. genro : peleo - Pelea specio : peleo kapreola - Pelea capreolus [redaktu]. subfamilio : Antilopenoj - Antilopinae. ... http://www.thedrakensberg.co.za/inf_fauna.html thedrakensberg.co.za: Adult male eland remain alone most of the year. Grey rhebuck [Pelea capreolus] They are the most commonly seen antelope in the Drakensberg. ... http://www.ecs.co.sz/bsap/chapter2.htm The Swaziland National Biodiversity Strategy and Action Plan: ...as regional endemics) including the birds: Oenanthe bifasciata, Geocolaptes olivaceus and Macronyx capensis; the mammals: Pelea capreolus, Otomys irroratus and ... http://www.jabali.co.za/animals/animaltype.cfm?page=vaal_rhebuck.htm Private Game Ranch in South Africa. Game, hiking, mountain biking ...: Vaal or Gray Rhebuck Afrikaans name : Vaalribbok Scientific name : (pelea capreolus). Region : The vaal rhebuck is a medium sized ... http://filin.km.ru/mammels/kobus.htm водÑ?ные козлы: предыдущему виду. ПЕЛЕÐ? (Pelea capreolus) Обитает в Южной Ð?фрике. МаÑ?Ñ?а взроÑ?лых ... http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Link&db=PubMed&dbFrom=PubMed&from_uid=12539743 Entrez PubMed: Abstract, Haemonchus horaki n. sp. (Nematoda: Trichostrongyloidea) from the grey rhebuck Pelea capreolus in South Africa. J Parasitol. 2001 Oct;87(5):1095-103. ... http://www.natureexpeditions.co.nz/southafrica_body.html Welcome to NZ Nature Expeditions: ...inhabit rivers and wetlands and the Cape region promises sightings of such species as Cape mountain zebra and the endemic Rhebok (Pelea capreolus), whose hair ... http://www.sun.ac.za/academic/Natural/consumer_science/ResReport2002.htm Research Report: M Verbruikerswet Studieleier: Hoffman LC, Muller M. VAN SCHALKWYK S. Meat quality characteristics of red rhebuck (Pelea Capreolus) and black wildebeest ... http://www.esapubs.org/archive/ecol/E084/093/Mammal_lifehistories_v2.txt order family Genus species mass(g) gestation(mo) newborn(g) ...: Bovidae Pantholops hodgsonii 27500.00 7.00 -999.00 -999.00 -999.00 -999.00 -999 1.00 -999.00 "1,2,17" Artiodactyla Bovidae Pelea capreolus 25000.00 8.70 ... http://www.soe.ucsc.edu/research/compbio/yeast-protein-predictions/Q011/Q0110/Q0110.t2k.pa.html a2m2html output for file tmp.a2m: ...rhomboides]. gi|4103286|gb|AAD13489.1|_2:292 cytochrome b [Pelea capreolus]. gi|16904622|dbj|BAB71989.1|_2:292 cytochrome b [Meles meles]. ... http://www.birdtours.co.uk/tripreports/namibia/namibia2/mammals.htm mammals: 35. LECHWE , Kobus leche, Moerasantilope 25+ at Mahango NP (N). 36. GREY RHEBOK , Pelea capreolus, Reeantilope Small numbers in the southwestern Cape (SA). 37. ... http://sege.ntu.edu.sg/cgi-bin/extract_info.pl?dbase=gbmam&field=protein&pop=69&type=1 Your Search Results: 113..735) , product("beta spectrin") VEDLLQKHALVEADIGIQAERVRGVNASAQKFATDGE{G}YKPCDPQVIRDRVAHMEFCYQELCQLAAERRAR > 54335_AF210208 Pelea capreolus beta spectrin ... http://www.acts.co.za/meat_safety/Schedule.htm Schedule 1 Animals to which this Act Applies: Elephant (Loxodonta africana). Gemsbuck (Oryx gazela). Gray Rhebok (Pelea capreolus). Hippopotamus (Hippopotamus amphibius). Impala (Aepyceros melampus). ... http://www.savci.upol.cz/sudokop.htm Artiodactyla - SudokopytnÃci: ...a. núbický, adas, a. nubický) - Addax. PodÄ?eleÄ?: srnÄ?à antilopky (Peleinae): Pelea capreolus (Forster, 1790) - antilopa srnÄ?à - Grey or Vaal Rhebok. ... http://www.knysna-info.co.za/english/content.asp?sectionid=241 [an error occurred while processing this directive] Pelea capreolus [an error occurred while processing this directive] 16484 Common Rhebok, Grey Rhebok Common Rhebok, Grey Rhebok Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |