|
|
Pinus krempfii -IUCN Status: VulnerableIUCN Species Profile http://www.botanik.uni-bonn.de/conifers/topics/newstuff.htm Notes and comments on new material: Lately, this has included information on Huon pine (Lagarostrobos franklinii), Pinus krempfii, and a bunch of big trees, notably the Coast Redwood, Sequoia ... http://forums.gardenweb.com/forums/load/conif/msg0417571425934.html pinus krempfii: ...pinus krempfii. Posted by Blue_yew Z9 Devon UK (My Page) on Tue, Apr 13, 04 at 17:57. Hello all ... Follow-Up Postings: RE: pinus krempfii. ... http://forums.gardenweb.com/forums/conif/nph-ind.cgi?n=200 Conifers Forum: 4 follow-ups, last one posted on Wed, Apr 14, 04 at 13:10. pinus krempfii: Posted by: Blue_yew Z9 Devon UK on Tue, Apr 13, 04 at 17:57: ... http://genetics.biology.kyushu-u.ac.jp/pgen/abstract/pk98.htm The phylogenetic position of <i>Pinus krempfii</i>: The phylogenetic position of the endemic flat-needle pine Pinus krempfii (Lec., Pinaceae) from Vietnam, based on PCR-RFLP analysis of chloroplast DNA. ... http://genetics.biology.kyushu-u.ac.jp/researchft.htm Research - Forest Trees: Pinus krempfii is morphologically very unique as compared to other Pinus species by having flat leaf-like needles (Fig. ... Figure 1. Leaves of Pinus krempfii. ... http://lsvl.la.asu.edu/lsem/text/SIB.htm ASU Life Sciences Electron Microscopy Facility: 1996. SEM OF CUTICLE MICROMORPHOLOGY OF PINUS KREMPFII LECOMTE AND ITS PUTATIVE PARENTS Stefanie Ickert-Bond -- Department of Botany ... http://www.upsc.nu/Default.asp?pageid=744&path=756%2C762%2C778 Välkommen till UPSC (Molecular evolution of plants - Alfred E. ...: PhD: Tsan-Piao Lin. Rates and Patterns of Nucleotide Substitution. Leaf-like needles of Pinus krempfii. The rate of nucleotide substitution ... http://tolweb.org/tree?group=Pinus&contgroup=Pinaceae Pinus: Bot. Gard. 73: 565-641. Erdtman, H., Kimland, B. and Norin, T. 1966. Wood constituents of Ducampopinus krempfii (Lecomte) Chevalier (Pinus krempfii Lecomte). ... http://www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=chloroplast+Pinus+krempfii+%5Bgbpln%5D Codon usage table: ...chloroplast Pinus krempfii [gbpln]: 1 CDS's (476 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU 29.4( 14) UCU ... http://www.flpa-images.co.uk/picdisplay.asp?GROUP=53558 FLPA - Images of Nature: Picture Group: PINUS KREMPFII We have 1 pictures of this subject in our library. Please contact us for details. Copyright Frank Lane ... http://membres.lycos.fr/helardot/page_pins/pinus_krempfii.htm PINUS krempfii Lecomte 1921: ...- Pinus krempfii Lecomte 1921. Synonymes. ducampopinus krempfii (Lec.) Chev. 1944 krempfii var. poilanei Lecomte 1924. Noms vernaculaires. pin du moyen Annam. ... http://www.pinetum.org/cones/PNDucampopinus.htm Arboretum de Villardebelle: Subsection Krempfianae. Pinus krempfii, ¤ Pinus krempfii Lecomte - Cone 6km SE of Bi Doup, Lam Dong Prov., Vietnam; 12° 01' N - 108° 41' E; 1790m. ... http://www.pinetum.org/danger.htm Arboretum de Villardebelle: ...- ... Pinus caribaea 97. Pinus cembroides lagunae 98. Pinus chiapensis 99. Pinus krempfii 100. Pinus merkusii 101. Pinus nelsonii 102. Pinus occidentalis 103. ... http://it.wikipedia.org/wiki/Pinus Pinus - Wikipedia: ...- Pinus. Da Wikipedia, l'enciclopedia libera. ... http://it.wikipedia.org/wiki/Pino Pinus - Wikipedia: ...- Pinus. Da Wikipedia, l'enciclopedia libera. (Reindirizzamento da Pino). ... http://www.lamdong.gov.vn/cdrom/lnghiep/TINHDADANG.HTM tinh da dang va dac tinh phan bo lop pinosida o lam dong: ...Ở tầng vượt tán có loà i Pinus krempfii, tán của chúng vượt lên tầng trên cùng và có dạng rẻ quạt. ... http://www.lamdong.gov.vn/cdrom/lnghiep/RungLD.htm Tai nguyen thuc vat rung lam dong: ...duperreana (Pierre) Dandy.), có những loà i đặc hữu ở Việt Nam: Thông 5 lá (Pinus dalatensis Deperré.), Thông 2 lá dẹp (Pinus krempfii Lecom ... http://www.fmnh.org/research_collections/pritzker_lab/pritzker/people/fellow_ickert.html Pritzker Laboratory - Research Assistants: Thesis title: Biosystematics of Pinus krempfii Lecomte. Ph.D. 2003. ... Reexamination of wood anatomical features in Pinus krempfii (Pinaceae). ... http://silva.tamu.edu/genetics/Seminars.html Invited Presentations: Pinus krempfii in Vietnam Vietnam National University - Ho Chi Minh City, Department of Botany January 1997. Research Importance of Pinus krempfii. ... http://131.220.103.1/conifers/topics/big_index.htm Gymnosperm Database complete taxonomic index: ...- ... Pinus jeffreyi, Pinus johannis, Pinus juarezensis, Pinus kesiya. Pinus koraiensis, Pinus krempfii, Pinus lagunae, Pinus lambertiana. Pinus ... http://pedant.gsf.de/cgi-bin/wwwfly.pl?Set=Euglena_gracilis_chloroplast&Alias=Euglena_gracilis_chloroplast&Page=taxrankspecies Euglena_gracilis_chloroplast: ...paramecium tetraurelia penicillium chrysogenum petunia x hybrida picea pungens picea sitchensis pinus balfouriana pinus edulis pinus krempfii pinus longaeva ... http://plant.csr.miyakyo-u.ac.jp/php/search.php?zokumei=%A5%DE%A5%C4%C2%B0 oNLINEæ¤?物アルãƒ?ム～ 検索画é?¢ ～: ...å¦å??：Pinus krempfii Lecomte. 別å??：ã?ªã?—. 29. ピーヌス・ケムブãƒã‚¤ãƒ‡ã‚¹ （0 件）, ... http://plant.csr.miyakyo-u.ac.jp/cgi/search.cgi?keyword=%A5%DE%A5%C4%B2%CA 検索完了: Abies balsamea Mill. ピーヌス・クレムプフィイ. マツ科, マツ属. Pinus krempfii Lecomte. ピーヌス・ケムブãƒã‚¤ãƒ‡ã‚¹. マツ科, マツ 属. ... http://lifesciences.asu.edu/herbarium/sbond/SB_MS_project.html Steffi M. Ickert-Bond: New World Ephedra and Pinus: Land of the great Pinus krempfii Lecomte. ... Publications: Ickert-Bond, SM 2001. Reexamination of wood anatomical features in Pinus krempfii (Pinaceae). ... http://lifesciences.asu.edu/herbarium/sbond/SB_education.html Steffi M. Ickert-Bond: New World Ephedra and Pinus: MS: 1997. Arizona State University. Thesis title: Biosystematics of Pinus krempfii Lecomte. Dipl. Ing.: 1994. Technische Fachhochschule Berlin, Germany. ... http://www.conifersociety.org/bulletin009.html American Conifer Society | Highlights from The Bulletin: Part 2 of the story will appear in the Spring 2002 Conifer Quarterly. Pinus krempfii: A Rare Pine from Vietnam By Richard Bond. Krempf ... http://www.bioone.org/bioone/?request=get-document&issn=0363-6445&volume=028&issue=04&page=0657 Phylogenetics of <GENSP>Pinus</GENSP> Subsections <GENSP> ...: Pinus krempfii, the sole member of this subgenus as recognized by Little and Critchfield (1969) , is a basal member of subgenus Strobus in molecular phylogenies ... http://www.bioone.org/bioone/?request=get-citation-links&doi=0378-2697(2000)220%3C0021:TPPOTE%3E2.0.CO;2&id=I0363-6445-028-04-0657-WANG1&sitename=BIOONE Citation Links: CITATION Wang, XR, Szmidt, AE, Nguyên, HN The phylogenetic position of the endemic flat-needle pine, Pinus krempfii (Pinaceae) from Vietnam, based on PCR-RFLP ... http://eol.sdsc.edu/perl/tax_beta.pl?type=down&val=58024 PAT NCBI Taxonomy Browser: ...*****139272, Pinus wallichiana, species. *****139272, Pinus krempfii, species. *****139272, Pinus lambertiana, species. ... http://www.smith.edu/garden/Newsletter/nlp10fall99.html Botanic Garden Newsletter, Fall 1999, page 10: ...and collect, Pinus krempfii. ... Each individual Pinus krempfii leaf has a greater surface area and more photosynthetic area than the typical pine needle. ... http://www.micro-genomes.mpg.de/cgi-bin/getblast.cgi?pir030305.orfprot.RB8459-rpsR.blastp getblast.pl beck@molgen-mpg.de: 35 0.30 SP_TREMBL:Q9TJB4 Q9tjb4 pinus nigra. ribosomal protein s18 (frag... 35 0.30 SP_TREMBL:Q9TJG0 Q9tjg0 pinus krempfii (krempf's pine). ribosoma... ... http://www.micro-genomes.mpg.de/cgi-bin/getblast.cgi?pir030305.orfprot.RB7115-rplT.blastp getblast.pl beck@molgen-mpg.de: ...ribo... 42 0.002 SP_TREMBL:Q9TJG1 Q9tjg1 pinus krempfii (krempf's pine). ribosoma... 41 0.002 SP_TREMBL:Q9TJF7 Q9tjf7 pinus pumila. ... http://www.infobiogen.fr/db/acnuc/nbrf/SPECIES Nª RACINE DþK CELLULAR ORGANISMS DþMÿÿÿü BIOTA Ö ...: ...- ... RESINOSA R Ng E STROBUS S E PINUS BALFOURIANA Nh E PINUS EDULIS Ni E PINUS WALLICHIANA T Nj E ÿÿþQ PINUS GRIFFITHII U ® PINUS KREMPFII Nk E ... http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?dopt=DocSum&cmd=Search&db=PubMed&orig_db=PubMed&term=loftextInfotrieve%5Bfilter%5D+AND+1058-5893%5Bta%5D+AND+2000%5Bdp%5D Entrez PubMed: Abstract, Cuticle Micromorphology of Pinus krempfii Lecomte (Pinaceae) and Additional Species from Southeast Asia. Int J Plant Sci. 2000 Mar;161(2):301-317. ... http://www.tempe.gov/newsbreak/2003/2002/032002/NewsBreakMarch_2002.htm NewsBreakMarch_2002: His findings were recently published in an article entitled, "Pinus krempfii: A rare pine from Vietnam," in the winter 2002 edition of The American Conifer ... http://www.journals.uchicago.edu/IJPS/journal/issues/v161n2/000020/000020.text.html Ickert-Bond, Cuticle Micromorphology: CUTICLE MICROMORPHOLOGY OF PINUS KREMPFII LECOMTE (PINACEAE) AND ADDITIONAL SPECIES FROM SOUTHEAST ASIA 1. ... Results. Pinus krempfii Lecomte (Figs. 2, 3). ... http://www.oralgen.lanl.gov/oralgen/bacteria/pgin/blast_results/PG0886.html PG0886: 45 2e-04 gi|6683433|dbj|BAA89190.1| ribosomal protein L20 [Pinus roxburghii] 45 2e-04 gi|6683343|dbj|BAA89130.1| ribosomal protein L20 [Pinus krempfii... ... http://www.oralgen.lanl.gov/oralgen/bacteria/smut/blast_results/SMu0639.html SMu0639: ...roxburghii] 53 8e-07 gi|6683355|dbj|BAA89138.1| ribosomal protein L20 [Pinus strobus] 53 1e-06 gi|6683343|dbj|BAA89130.1| ribosomal protein L20 [Pinus krempfii ... http://www.rhs.org.uk/research/registration_conifers_accepted.asp Royal Horticultural Society - Research: ...kesiya Pinus kesiya var. langbianensis (A. Chev.) Gaussen ex NS Bui (1962) Pinus koraiensis Siebold & Zucc. (1842) Pinus krempfii Lecomte (1921) Pinus ... http://www.biologie.uni-ulm.de/extern/guenterstal/arboret.htm Arboretum: ...- ... retroflexa A; Pinus gerardiana A G; Pinus halepensis var. eldarica G; Pinus heldreichii; Pinus jeffreyi A G; Pinus koraiensis A G; Pinus krempfii; ... http://www.unep-wcmc.org/infoserv/countryp/vietnam/app5.html Threatened plant listing for Viet Nam: Mzt. 18270 nt Pinus kesiya Royle ex Gordon 8320 E Pinus krempfii Lecomte 6057 V Pinus kwangtungensis Chun & Tsiang 17617 R Pinus latteri Mason 18270 nt Pinus ... http://www.chickest.udel.edu/orthochick/c165.html BLAST Search Results: ...chloroplast gene f... 33 9.2 dbj|AB019869.1|AB019869 Pinus cembra chloroplast gene for t... 33 9.2 dbj|AB019868.1|AB019868 Pinus krempfii chloroplast gene for ... http://intl.amjbot.org/cgi/content/full/86/12/1742 Am. J. Bot. -- Wang et al. 86 (12): 1742: Pinus krempfii, the two-flat-needle pine endemic to Vietnam, was placed in subgen. ... Pinus krempfii was sister species to the sect. Strobus clade. ... http://aquadb.nrifs.affrc.go.jp/~aquadb/cgi-bin/tax_hl.cgi?TTAXID=3342 Tax Data: Pinus krempfii, Krempf's pine,, select language. jp. HELP. ... species(種), Pinus wallichiana, ddbj information. species(種), Pinus krempfii, ddbj information. ... http://aquadb.nrifs.affrc.go.jp/~aquadb/cgi-bin/tax_hl.cgi?TTAXID=3338 Tax Data: ...species(種), Pinus wallichiana, ddbj information. species(種), Pinus krempfii, ddbj information. species(種), Pinus lambertiana, ddbj information. ... http://walnut.bioc.columbia.edu/srs7bin/cgi-bin/wgetz?-id+4xSuH1M08Rl+%5Bswissprot-AccNumber:P26963%5D+-e Entry Page: ...rubisco large subunit). Gene name(s), rbcl. Organism source, Pinus krempfii (Krempf's pine). Organism classification, Eukaryota; Viridiplantae ... http://genome.jgi-psf.org/cgi-bin/dispGeneModel.v4?db=thaps1&id=98891 Protein Pages: Thalassiosira pseudonana (Diatom): ...genome.jgi-psf.org/cgi-bin/ dispGeneModel.v4?db=thaps1&id=98891 - 24k - Cached - Similar pages BLASTP 2.0.11 [Jan-20-2000] Reference ... M +P +D Sbjct: 72 VDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKD 126 dbj|BAA89131.1| (AB019905) ribosomal protein S18 [Pinus krempfii] >gi|6683347|dbj ... http://spock.jouy.inra.fr/NCBI/rpsR.html BLASTP 2.0.11 [Jan-20-2000] Reference: M +P +D Sbjct: 72 VDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKD 126 dbj|BAA89131.1| (AB019905) ribosomal protein S18 [Pinus krempfii] >gi|6683347|dbj ... http://spock.jouy.inra.fr/NCBI/rplT.html BLASTP 2.0.11 [Jan-20-2000] Reference: LWI RINAAAR NG+SY++ + L + NRK L Sbjct: 2 LWITRINAAARANGVSYNRFIQYLYKRQLLPNRKTL 37 dbj|BAA89130.1| (AB019905) ribosomal protein L20 [Pinus krempfii] >gi|6683346 ... http://www.kuleuven.ac.be/bio/sys/iawa/abstracts/contents22_4.htm Abstracts: ...aspects of Norway spruce tracheids: A review IAWA J. 22 (4): 333-353 SM ICKERT-BOND Reexamination of wood anatomical features in Pinus krempfii (Pinaceae) IAWA ... http://www.kuleuven.ac.be/bio/sys/iawa/abstracts/abs22_4/abs22_4%20355.htm Abstracts: SM ICKERT-BOND Reexamination of wood anatomical features in Pinus krempfii (Pinaceae) IAWA J. 22 (4): 355-365 Wood anatomy of Pinus krempfii Lecomte, a pine ... http://magnolia.s.kanazawa-u.ac.jp/kueda/rbcL_all.html All rbcL data in DNA Databank1: Pinus balfouriana ACCESSION X63661 Pinus edulis ACCESSION X58137 16-MAY-1997 Pinus griffithii ACCESSION X58131 16-MAY-1997 Pinus krempfii ACCESSION X63665 ... http://www.wrm.org.uy/plantations/information/Lang1.html GLOBALIZATION OF THE PULP AND PAPER INDUSTRY: CSIRO was interested in the possibility of seed exchange, particularly of the Vietnamese species Pinus krempfii - "a rare species from the highlands of central ... http://taxon.molgen.mpg.de/gettaxon?taxid=3342 TAXON Query Form: Taxonomic subtree rooted by TaxID 3342 (Pinus krempfii). species: Pinus krempfii (TaxID 3342, info). complete lineage of Pinus krempfii (TaxID 3342): Tax. ... http://www.stdgen.lanl.gov/oralgen/bacteria/smut/blast_results/SMu0639.html [an error occurred while processing this directive] Pinus krempfii [an error occurred while processing this directive] 32804 Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |