|
|
Pseudalopex sechurae - Sechura Fox, Sechuran ZorroIUCN Status: Data DeficientIUCN Species Profile http://www.canids.org/SPPACCTS/dsechura.htm Sechuran Zorro (Pseudolopex sechurae): Sechuran zorro (Pseudalopex sechurae)*. (* formerly classified as Dusicyon sechurae). ... Asa, CS and CossÃos, ED In press. Sechuran fox (Pseudalopex sechurae). ... http://www.canids.org/SPPACCTS/sppaccts.htm Canid Species Accounts: Sechuran zorro (zorro costeño) (Pseudalopex sechurae) [formerly (Dusicyon sechurae)]; Small-eared zorro (Atelocynus microtis) [formerly (Dusicyon microtis)]. ... http://www.lioncrusher.com/animal.asp?animal=29 Lioncrusher's Domain -- Sechuran Zorro (Pseudalopex sechurae) ...: Sechuran Zorro (Pseudalopex sechurae). Range and Habitat The sechuran zorro ranges in southern Ecuador and northern Peru, preferring the grasslands and semi ... http://www.lioncrusher.com/family.asp?family=Canidae Lioncrusher's Domain -- Canidae: Lioncrusher's Domain > Canidae, The Canidae Family. Sort by common name or by scientific name. Species: ... http://animaldiversity.ummz.umich.edu/site/accounts/classification/Pseudalopex_sechurae.html ADW: Pseudalopex sechurae: Classification: Pseudalopex sechurae (Sechura fox). Classification. ... Parent taxa. specimens. Genus Pseudalopex (South American foxes). Species Pseudalopex sechurae (Sechura fox). ... http://animaldiversity.ummz.umich.edu/site/accounts/classification/path/Pseudalopex_sechurae.html.html ADW: Pseudalopex sechurae: Classification: Pseudalopex sechurae (Sechura fox). Classification. ... specimens. Genus Pseudalopex (South American foxes). Species Pseudalopex sechurae (Sechura fox). ... http://www.itis.usda.gov/servlet/SingleRpt/SingleRpt?search_topic=TSN&search_value=621856 ITIS Standard Report Page: Pseudalopex sechurae: Go to Print Version, Pseudalopex sechurae (Thomas, 1900) Taxonomic Serial No.: 621856. ... Species, Pseudalopex sechurae (Thomas, 1900) -- Sechura fox, References, ... http://www.itis.usda.gov/servlet/SingleRpt/RefRpt?search_type=expert&search_id=expert_id&search_id_value=102 ITIS 'Expert(s)' Search results for W. Christopher Wozencraft: Pseudalopex gymnocercus (G. Fischer, 1814) -- valid -- Pampas fox. Pseudalopex sechurae (Thomas, 1900) -- valid -- Sechura fox. Pseudalopex ... http://www.vision.ime.usp.br/~maki/ERIKA/MAR_2003_NOVO/fs_comb2_class8.html Classe 8: 13 e 14: Pseudalopex-gymnocercus - fêmeas/machos. 15 e 16: Pseudalopex-sechurae - fêmeas/machos. ... CLASSE 8: Pseudalopex-sechurae. Distancia: 0.89371. ... http://www.fact-index.com/c/ca/canidae.html Canidae: ...griseus; Pampas Fox, Pseudalopex gymnocercus; Sechura Fox, Pseudalopex sechurae; Hoary Fox, Pseudalopex vetulus. Genus Cerdocyon: Crab ... http://www.tunturisusi.com/sechurankettu.html Sechurankettu: Your browser does not support script. Sechurankettu (Pseudalopex sechurae). Sechuranketulla on painoa 4 - 5 kg ja se on Etelä-Amerikan zorroja. ... http://www.tunturisusi.com/canidae.html SUSI CANIS LUPUS: Your browser does not support script. Canidae koiraeläimet. Canidae koiraeläimet heimoon kuuluu yhteensä 14 sukua ja 35 lajia. ... http://www.net-lexikon.de/Hunde.html Lexikon - Hunde Definition Erklärung Bedeutung: ...- ... Pampasfuchs (Pseudalopex gymnocercus); Sechurafuchs (Pseudalopex sechurae); Brasilianischer Kampfuchs (Pseudalopex vetulus). Gattung ... http://www.damisela.com/zoo/mam/carnivora/canidae/nombres.htm Caninos: ...- ... Zorro Gris Mayor, Azara's Fox, Pseudalopex gymnocercus. Zorrito del Desierto, Sechuran Fox, Pseudalopex sechurae. Zorro Raposa de Campo, Hoary Fox, Pseudalopex vetulus. ... http://nl.wikipedia.org/wiki/Canidae Canidae - Wikipedia NL: Pseudalopex culpaeus; Soort: Pseudalopex griseus; Soort: Pseudalopex gymnocercus; Soort: Pseudalopex sechurae; Soort: Pseudalopex vetulus. ... http://home.globalcrossing.net/~brendel/canidae.html FAMILY CANIDAE: Pseudalopex gymnocercus inca. Pseudalopex microtis. Pseudalopex sechurae (South American fox). Pseudalopex vetulus (Hoary fox). Genus Speothos. ... http://home.globalcrossing.net/~brendel/carniv.html ORDER CARNIVORA: Pseudalopex griseus (Argentine gray fox). Pseudalopex gymnocercus (South American fox). Pseudalopex sechurae (South American fox). Pseudalopex vetulus (Hoary fox). ... http://www.animalomnibus.com/dogs.htm Canids - Family Canidae: Pseudalopex vetulus or Dusicyon vetulus: Hoary Zorro (Dusicyon vetulus). Sechuran Zorro - Pseudalopex sechurae or Dusicyon sechurae: ... http://www.hundewelpen.de/hunde.htm Hunde Definition, Bedeutung: ...- ... culpaeus) Argentinischer Kampfuchs (Pseudalopex griseus) Pampasfuchs (Pseudalopex gymnocercus) Sechurafuchs (Pseudalopex sechurae) Brasilianischer Kampfuchs ... http://hunde.bizkitt.de/Hunde_9686.html **Hunde** Infomationen zu Hunde: ...- ... Argentinischer Kampfuchs (Pseudalopex griseus) -** Pampasfuchs (Pseudalopex gymnocercus) -** Sechurafuchs (Pseudalopex sechurae) -** Brasilianischer Kampfuchs ... http://www.animais.villenet.com.br/htmlgalerias/frame_especie_pseudalopex_sechurae.htm Leão, Tigre & Cia. - Galeria Pseudalopex sechurae - www.animais. ...: ...- www.animais.villenet.com.br/htmlgalerias/ frame_especie_pseudalopex_sechurae.htm - 1k - Cached - Similar pages Liska's EncycVulpedia: Foxes Around the World ... or Argentine grey fox (Pseudalopex griseus), the pampas grey fox (Pseudalopex gymnocercus), the sechuran or Peruvian desert fox (Pseudalopex sechurae), and the ... http://mynarskiforest.purrsia.com/ev28wrld.htm Liska's EncycVulpedia: Foxes Around the World: ...or Argentine grey fox (Pseudalopex griseus), the pampas grey fox (Pseudalopex gymnocercus), the sechuran or Peruvian desert fox (Pseudalopex sechurae), and the ... http://www.furry.de/suran/fox_db/Species_overview.html Vulpes World - Fox Database - Species Overview: ...fox. Pseudalopex griseus Gray Zorro (South American grey fox). Pseudalopex sechurae Grey zorro (South American grey fox). Pseudalopex ... http://www.searchingwolf.com/w_canids.htm The Gray Wolf Course - Other Canids: Pseudalopex culpaeus (Culpeo) Pseudalopex griseus (Chilla) Pseudalopex gymnocercus (Pampas Fox) Pseudalopex sechurae (Sechura Fox): ... http://www.il-st-acad-sci.org/mammals/dog002.html CANIDEA: Island fox, Urocyon littoralis. Hoary fox, Lycalopex vetulus. Coastal South American fox, Pseudalopex sechurae. Southern South American fox, Pseudalopex griseus. ... http://www.savci.upol.cz/selmy.htm Carnivora - Å elmy: Pampas Fox: (syn. Dusicyon gymnocercus) Pseudalopex sechurae (Thomas, 1900) - pes pouÅ¡tnà - Sechura Fox: (syn. Dusicyon sechurae ... http://www.peruecologico.com.pe/lib_c8_t05.htm La fauna de las lomas costeras: ...- ... Los carnÃvoros están representados por el zorro andino o atoj (Pseudalopex culpae), el zorro de Sechura (Pseudalopex sechurae), el puma (Felis concolor), el ... http://www.peruecologico.com.pe/lib_c7_t05.htm La fauna terrestre del bosque seco: ...- ... stramineus). Entre los carnÃvoros existe el zorro de Sechura (Pseudalopex sechurae), un cánido pequeño, omnÃvoro y muy común. ... http://www.animales.cl/Bases/nota.asp?nota=16 Nota: ...- Los Zorros chilenos Hay cuatro especies de zorros en Sudamérica Pseudalopex sechurae: zona costera árida del sudoeste de Ecuador y noroeste del Perú. ... http://www.terrambiente.org/fauna/Mammiferi/carnivora/canidae/ Canidae: ...- ... Pseudalopex, dusicyon_vetulus1.jpg (29561 byte), Pseudalopex griseus, Pseudalopex culpaeus, Pseudalopex, gymnocercus, Pseudalopex sechurae, Pseudalopex, vetulus. ... http://perso.club-internet.fr/boudetjo/ZooList/Mammif/DangCarn.html Carnivores en danger: CITES - Appendix II. Pseudalopex sechurae, Renard du désert austral, de Sechura, Sechura desert fox, Sechuran zorro, Dusicyon sechurae, (Thomas, 1900). ... http://perso.club-internet.fr/boudetjo/ZooList/Mammif/ClasCarn.html Classification des Carnivores: ...- ... pictus Nyctereutes procyonoides Otocyon megalotis Pseudalopex culpaeus Pseudalopex griseus Pseudalopex gymnocercus Pseudalopex sechurae Pseudalopex vetulus ... http://www.shaman.cz/Carnivora/Canidae.htm Shaman.cz - Carnivora - Psovité Å¡elmy (Canidae): Druh Pseudalopex sechurae (Thomas, 1900) - Pes pouÅ¡tnÃ; Druh Pseudalopex vetulus (Lund, 1842) - Pes Å¡edý (p. Azarův, liÅ¡ka Azarova). ... http://www.shaman.cz/Carnivora/RejstrikLat.htm Shaman.cz - Carnivora - Jmenný rejstÅ™Ãk latinských názvů: ...griseus (druh) - Pes argentinský, patřà mezi Psovité Pseudalopex gymnocercus (druh) - Pes pampový, patřà mezi Psovité Pseudalopex sechurae (druh) - Pes ... http://artemida.amu.edu.pl/~terio/carnivora/ Sekcja Teriologiczna KNP UAM: Pseudalopex culpaeus- lis andyjski · Pseudalopex griseus- lis szary · Pseudalopex gymnocercus- lis pampasowy · Pseudalopex sechurae- sechura · Pseudalopex ... http://www.tutorgig.com/encyclopedia/getdefn.jsp?keywords=Canidae Canidae | TutorGig.com Encyclopedia: ...griseus; Pampas Fox , Pseudalopex gymnocercus; Sechura Fox , Pseudalopex sechurae; Hoary Fox , Pseudalopex vetulus. Genus Cerdocyon: ... http://www.tutorgig.com/encyclopedia/getdefn.jsp?keywords=canidae TutorGig.com Encyclopedia | canidae: Culpeo , Pseudalopex culpaeus Argentine Grey Fox , Pseudalopex griseus Pampas Fox , Pseudalopex gymnocercus Sechura Fox , Pseudalopex sechurae Hoary Fox ... http://www.natureserve.org/infonatura/speciesIndex/Family_Canidae_100153_1.htm InfoNatura Species Index: Family Canidae: LMJA005040, Pseudalopex gymnocercus Pampas Fox, G4, 2, Countries: AR, BO, BR, PY, UY. LMJA005060, Pseudalopex sechurae Sechura Fox, G1, DD, Countries: EC, PE. ... http://www.phthiraptera.org/Mammals/Canidae.html Mammals: Canidae: Linognathus taeniotrichus Werneck, 1937 ( type host ?). Pseudalopex sechurae (Thomas, 1900) - Sechura Fox; Pseudalopex vetulus (Lund, 1842) - Hoary Fox Speothos. ... http://wikipedia.infostar.cz/c/ca/canidae.html Canidae: ...griseus; Pampas Fox, Pseudalopex gymnocercus; Sechura Fox, Pseudalopex sechurae; Starodávná liÅ¡ka, Pseudalopex vetulus. Rod Cerdocyon: ... http://www.avesdelima.com/paracas.htm Aves de Paracas Ica Peru - Birding in Paracas Ica Peru: ...- ... En tierra ocasionalmente se deja ver deambulando por la reserva al Zorro Costeño (Pseudalopex sechurae), al que también se le encuentra en las Lomas de ... http://www.inrena.gob.pe/dganp_cat_rn_03.html Areas Naturales Protegidas - RN Paracas: ...- ... En el ámbito terrestre, el mayor representante de los mamÃferos es el zorro costeño (Pseudalopex sechurae) que ocasionalmente puede ser visto caminando por ... http://www.inrena.gob.pe/dganp_cat_rn_04.html Areas Naturales Protegidas - RN Lachay: ...- ... Los mamÃferos más abundantes son los roedores, aunque pueden encontrarse también otras especies como el zorro costeño (Pseudalopex sechurae), el zorrino ... http://www.enjoyperu.com/peru_travel_tours_information/peru_nature_ecology_biodiversity/peru_nature_ecology_biodiversity_national_reserves_paracas_national_reserve.html PERU NATIONAL RESERVES - PARACAS IN PERU: We con also observe the coastal wolf (Pseudalopex sechurae), that sometimes you can see it walking through the desert next to the beach, bats are found in the ... http://www.enjoyperu.com/peru_travel_tours_information/peru_nature_ecology_biodiversity/peru_nature_ecology_biodiversity_national_reserves_calipuy_national_reserve.html PERU NATIONAL RESERVES - CALIPUY IN PERU: There are some protected species like the puma (Puma concolor), the coastal wolf (Pseudalopex sechurae), the vizcacha (Lagidium peruanum), the spectacted bear ... http://www.perutravels.net/peru_travel_information/nature_ecology/national_protected_areas/national_reserves_peru/calipuy.htm Calipuy National Reserve Peruvian National Reserves by Peru ...: ...guanicoe) living in the National Reserve.There are some protected species like the puma (Puma concolor), the coastal wolf (Pseudalopex sechurae), the vizcacha ... http://www.perutravels.net/peru_travel_information/nature_ecology/national_protected_areas/national_reserves_peru/paracas.htm Paracas National Reserve Peruvian National Reserves by Peru ...: We can also observe the coastal wolf (Pseudalopex sechurae), that sometimes you can see it walking through the desert next to the beach, bats are found in the ... http://www.bvet.admin.ch/artenschutz/d/vollzugshilfen/as116/pelze/systematik/canidae_df.html 820.116.01 (3): PELZFELLE: I, Volpe azara Volpe sudamericana Volpe grigia delle Pampas, "Aguarachai". Dusicyon (=Pseudalopex) sechurae, E, Sechura Fox, F, S, Zorro costero Zorro de Sechura, ... http://www.parkswatch.org/parkprofile.php?l=eng&country=per&park=canr&page=bio Calipuy National Reserve and Calipuy National Sanctuary - Park ...: Key fauna species in the area include: the guanaco (Lama guanicoe), puma (Felis concolor), coastal fox (Pseudalopex sechurae), Andean fox (Pseudalopex culpaeus ... http://www.parkswatch.org/parkprofile.php?l=eng&country=per&park=lanr&page=bio Lachay National Reserve - Park Profile - Biodiversity: ...marsupial. The Sechura fox (Pseudalopex sechurae) and the pampas cat (Oncifelis colocolo) are occasional reserve residents. Some ... http://encyclopedia.thefreedictionary.com/Canidae Canidae - encyclopedia article about Canidae. Free access, no ...: ...culpaeus; Argentine Grey Fox, Pseudalopex griseus; Pampas Fox, Pseudalopex gymnocercus; Sechura Fox, Pseudalopex sechurae; Hoary Fox ... http://www.worldwildlife.org/wildworld/profiles/terrestrial/nt/nt1315_full.html Terrestrial Ecoregions -- Sechura desert (NT1315): Distinctive and restricted range species include Sechura fox (Pseudalopex sechurae), Roedinger's lance head (Bothrops roedingeri), Pizarrita slenderbilled ... http://www.worldwildlife.org/wildworld/profiles/terrestrial/nt/nt0163_full.html Terrestrial Ecoregions -- Solimões-Japurá moist forest (NT0163): Goeldi’s marmosets (Callimico goeldii), jaguars (Panthera onca), margays (Leopardus wiedii), South American foxes (Pseudalopex sechurae), bats such as yellow ... http://genomebiology.com/2003/4/6/p6/table/T2 Table 2: 9, C. latrans, Coyote, North America, AF028140, [8]. 10, Pseudalopex sechurae, Desert fox, NW S. America, AF028154, [8]. Complete Cytochrome-b gene reference sequences. ... http://peru.gotolatin.com/eng/Guide/PeruNationalParks/Paracas/Paracas-1.asp Peru Guia de Parques Reserva Nacional Paracas: On land, the greatest representation of the mammals is the Peruvian desert fox (Pseudalopex sechurae) which occasionally can be seen walking through the desert ... http://peru.gotolatin.com/eng/Guide/PeruNationalParks/LomasLachay/Lomas-Lachay-1.asp Peru Guia de Parques Lomas de Lachay: The common mammals found here are the rodents, but you can also find other species like the Sechuran Zorro(fox) (Pseudalopex sechurae), the Andean Skunk ... http://www.rickertweb.com/~justin/School/CS360%20Database%20Systems/PC2/SQL/1e.txt SQL> @c:\1e.sql NAME PRINTNAME ...: ...gymnocercus Pseudalopex gymnocercus Azara's fox (English); sechurae Pseudalopex sechurae Sechura desert fox, Sechuran zorro (English); vetulus Pseudalopex ... http://www.rickertweb.com/~justin/School/CS360%20Database%20Systems/PC4/Data/TAXON/CARNIV.txt ME MYPARENT RORDER NAME TAXON PRINTNAME AUTHOR CITATION COMMON_NM ...: Brazil; E Bolivia. CITES - Appendix II. 51 47 0 sechurae SPECIES Pseudalopex sechurae (Thomas, 1900). Ann. Mag. Nat. Hist., ser. 7, 5 ... http://www.undp.org.vn/mlist/envirovlc/092001/post62.htm [enviro-vlc] An appeal for information on certain Canid species: ...fox (Vulpes pallida), Rüppell's fox (Vulpes rueppelli) South America: Hoary zorro (Pseudalopex vetulus), Sechuran zorro (Pseudalopex sechurae), Small-eared ... http://www.nih.go.jp/yoken/genebank/MNCb/seq5/MNCb-0543.BLA BLASTN 2.0a2MP-WashU [20-Oct-1996] [Build 22:58:53 Oct 20 1996] ...: 1285 7.8e-52 1 OM|AF028190||| AF028190 Canis mesomelas elongae isolate 1... 1281 1.0e-51 1 OM|AF028202||| AF028202 Pseudalopex sechurae cytochrome c... 1280 1.2 ... http://www.nationmaster.com/encyclopedia/Canidae Encyclopedia: Canidae: ...griseus. Pampas Fox, Pseudalopex gymnocercus. Sechura Fox, Pseudalopex sechurae. Hoary Fox, Pseudalopex vetulus. Genus Cerdocyon: Crab ... http://www.unmsm.edu.pe/biologia/reunion/c8e08.htm Página de la Facultad de Ciencias Biologicas: ...- ... Se incluye en esta parte del estudio la composición de la dieta del zorro costeño: Pseudalopex sechurae y se analizan las fluctuaciones poblacionales de 4 ... http://www.darwinac.com/peninsulavaldes/patagonia/animals/mammals/carnivoro.htm carnivoros, carnivora: ...fox). Pseudalopex gymnocercus (South American fox) , Pseudalopex sechurae (South American fox) , Pseudalopex vetulus (Hoary fox). ... http://genoma.unsam.edu.ar/projects/tupaia/blast_dir/nr/tu.fasta.screen.Contig280.br BLASTX 2.1.3 [Apr-1-2001] Reference: Altschul, Stephen F., Thomas ...: AF028201) cytochrome c oxidase subunit I [Pseudalopex gymnocercus] gb|AAC00095.1| (AF028202) cytochrome c oxidase subunit I [Pseudalopex sechurae] gb|AAC00096.1 ... http://www.interaktv.com/mammals/carnivora.html Biologybase: Mammals of the World: Carnivora (the carnivores): Pseudalopex culpaeus. Pseudalopex griseus. Pseudalopex gymnocercus. Pseudalopex sechurae. Pseudalopex vetulus. Speothos venaticus. Urocyon cinereoargenteus. ... http://ja.wikipedia.org/wiki/%E3%82%A4%E3%83%8C%E7%A7%91 イヌ科 - Wikipedia: ...パンパスギツãƒ?ã€?Pseudalopex gymnocercus (en:Pampas Fox); ã€?Pseudalopex sechurae (en:Sechura Fox); ã€?Pseudalopex vetulus (en:Hoary Fox). [編集]. ... http://www.esi.umontreal.ca/~bourdeav/HH/DB_HH/HTML/HH-I-iiiGU/HH-I-iiiGU.mam.sol.filN.html HH-I-3: 55 nuc ..|GUC|GAA|GC|UCUCCUGGUUUUAAUUCUUGU|GU|U|GGG| --- AF028226 Pseudalopex sechurae cytochrome c oxidase subunit II (COII) gene, --- (684 bases ... http://www.nmnh.si.edu/msw/mammals_checklist.txt Monotremata Tachyglossidae Tachyglossus Tachyglossus aculeatus ...: ...procyonoides Otocyon Otocyon megalotis Pseudalopex Pseudalopex culpaeus Pseudalopex griseus Pseudalopex gymnocercus Pseudalopex sechurae Pseudalopex vetulus ... http://www.sciforums.com/showthread.php?t=36824&goto=nextoldest sciforums.com - dogs survival: Pseudalopex culpaeus (culpeo fox) * Pseudalopex griseus (Argentine gray fox) * Pseudalopex gymnocercus (pampas fox) * Pseudalopex sechurae (Sechura desert fox ... http://srs.pku.edu.cn/srs7bin/cgi-bin/wgetz?-id+lvNB1EbOmM+%5Bswissprot-AccNumber:O47678%5D+-e Entry Page: EC 1.9.3.1). GN MTCO2 OR COII. OS Pseudalopex sechurae (Sechura desert fox) (Sechuran zorro). OG Mitochondrion. OC Eukaryota; Metazoa ... http://srs.sanger.ac.uk/srs5bin/cgi-bin/wgetz?-id+2keC41M_g7t+%5Bswissprot-AccNumber:O47678%5D+-e Entry Page: 3.1). Gene name(s), mtco2 or coii. Organism source, Pseudalopex sechurae (Sechura desert fox) (Sechuran zorro). Organism classification, ... http://taxon.molgen.mpg.de/gettaxon?taxid=9608 TAXON Query Form: ...species: Pseudalopex gymnocercus (TaxID 68738, info); species: Pseudalopex sechurae (TaxID 68739, info). genus: Speothos (TaxID 68740 ... http://members.fortunecity.es/proferoxana/Protejamos.a.los.animales.htm Protejamos a los animales: ...- ... Los Zorros chilenos Hay cuatro especies de zorros en Sudamérica Pseudalopex sechurae: zona costera árida del sudoeste de Ecuador y noroeste del Perú. ... http://peopleandwildlife.org.uk/canid-db-search.php Canid Database -: ...peopleandwildlife.org.uk/canid-db-search.php - 15k - Cached - Similar pages Canid Database - Add Projectpeopleandwildlife.org.uk/canid-db-add.php - 22k - Cached - Similar pages [PDF] On the rarity of big fierce carnivores and primacy of isolation ...File Format: PDF/Adobe Acrobat - View as HTMLPage 1. FirstCite e-publishing Received 7 October 2003 Accepted 19 January 2004 Published online On the rarity of big fierce ... http://peopleandwildlife.org.uk/canid-db-add.php Canid Database - Add Project: ...peopleandwildlife.org.uk/canid-db-add.php - 22k - Cached - Similar pages [PDF] On the rarity of big fierce carnivores and primacy of isolation ...File Format: PDF/Adobe Acrobat - View as HTMLPage 1. FirstCite e-publishing Received 7 October 2003 Accepted 19 January 2004 Published online On the rarity of big fierce ... http://parasite.vetmed.ufl.edu/html/est/Pb/031/031PbF05.html National Center for Biotechnology Information (NCBI) welcome to ...: 93 sp|O47678|COX2_PSESU CYTOCHROME C OXIDASE POLYPEPTIDE II >gi|2826631 (AF028226) cytochrome c oxidase subunit II [Pseudalopex sechurae] Length = 227 Score ... http://nema.cap.ed.ac.uk/nematodeESTs/Ascaris/Ascaris300-324/Asmc-319xnr.html National Center for Biotechnology Information (NCBI) welcome to ...: Sbjct: 169 GLKTDAIPGRLNQTTLMAMRPGLYYGQCSEICGSNHSFMPIVLEMVPLSYFETW 222 gi|2826631 (AF028226) cytochrome c oxidase subunit II [Pseudalopex sechurae] Length = 227 ... http://br.groups.yahoo.com/group/news_leao_tigre_cia/message/13 [an error occurred while processing this directive] Pseudalopex sechurae [an error occurred while processing this directive] 6925 Sechura Fox, Sechuran Zorro Sechura Fox, Sechuran Zorro Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |