|
|
Rattus fuscipes - Bush RatIUCN Status: Lower Risk/Least ConcernIUCN Species Profile http://www.epa.qld.gov.au/site_information/site_index/b/ B - EPA/QPWS: Burhinus grallarius. Burleigh Head National Park. Burrum Coast National Park. bush rat Rattus fuscipes. bush stone-curlew Burhinus grallarius. bushwalking. ... http://wildscenes.com.au/wildslides/bush%20rat.htm Bush Rat (Rattus fuscipes): Bush Rat. Rattus fuscipes. Join our Electronic Newsletter. Enter Your E-mail. Gain Field Experience Our trips are based on bushwalking ... http://wildscenes.com.au/bargo/biologic.htm 6. Biological Diversity: Site 1 had no captures or sightings; site 2 had a low capture rate of 7.5%, with 2 Rattus fuscipes and 1 Cercatetus nanus being caught; site 3 had a high ... http://faunanet.gov.au/wos/factfile.cfm?Fact_ID=309 Wildlife of Sydney - Fact File - Bush Rat: Bush Rat Fact File. Rattus fuscipes. Rattus fuscipes Photo: Nature Focus. The Bush Rat can be quite difficult to find because of its ... http://faunanet.gov.au/wos/group.cfm?Group_ID=38 Wildlife of Sydney - Possums, bats, whales and other mammals ...: Possums, bats, whales and other mammals - Mammalia. Sydney is home to a range of mammal species, both native and introduced. Some ... http://www.viridans.com/mampics/rmamm.htm Mammal Images - R: Broad-toothed Mastacomys fuscus © Tony Robinson (1438ctr1) Rat; Brown Rattus norvegicus © Wendy Opie (1409awlo) Rat; Bush Rattus fuscipes © Tony Robinson ... http://www.viridans.com/mampics/bmamm.htm Mammal Images - B: Mountain pygmy-possum © Tony Robinson (1156ctr1) Burramys parvus Mountain pygmy-possum © Tony Robinson (1156dtr1) Bush Rat Rattus fuscipes © Tony Robinson ... http://www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=Rattus+fuscipes+%5Bgbrod%5D Codon usage table: Rattus fuscipes [gbrod]: 5 CDS's (622 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU 9.6( 6) UCU 11.3( 7) UAU ... http://www.kazusa.or.jp/codon/R.html Alphabetical list: R: Rat sialodacryoadenitis coronavirus [gbvrl]: 10 Rathayibacter rathayi [gbbct]: 2 Rattus evereti [gbrod]: 1 Rattus exulans [gbrod]: 3 Rattus fuscipes [gbrod]: 5 ... http://wwildlife.com/www/biodiversity/mammals.htm Wandering Wildlife Website: A bushrat, Rattus fuscipes assimilis, and a long-nosed bandicoot, Perameles nasuta, were found in the traps and an antechinus, Antechinus stuartii stuartii ... http://evol.allenpress.com/evolonline/?request=get-abstract&issn=0014-3820&volume=057&issue=05&page=1182 SPATIAL AUTOCORRELATION ANALYSIS OFFERS NEW INSIGHTS INTO GENE ...: Evolution: Vol. 57, No. 5, pp. 1182–1195. SPATIAL AUTOCORRELATION ANALYSIS OFFERS NEW INSIGHTS INTO GENE FLOW IN THE AUSTRALIAN BUSH RAT, RATTUS FUSCIPES. ... http://evol.allenpress.com/evolonline/?request=get-keyword-index&issn=0014-3820&volume=057 Evolution: Raphanus raphanistrum, [Abstract] [Full-text Article] [Print Version]. Rattus fuscipes, [Abstract] [Full-text Article] [Print Version]. ... http://www.chez.com/rodent/Muridae/Muridae.html Muridae: Rattus feliceus - Spiny Seram, Pepina's rat -. Rattus foramineus - Mekongga rat -. Rattus fuscipes - Southern bush rat -. Rattus hoffmanni - Hoffman's rat -. ... http://users.senet.com.au/~fobhm/morialta_animal.htm Friends of Black Hill and Morialta Conservations Parks Inc ...: Common Ringtail, Pseudocheirus peregrinus. Bush Rat, Rattus fuscipes. Bush Rat, Rattus fuscipes greyii. Brown Rat (Sewer Rat or Norway Rat), Rattus norvegicus. ... http://users.senet.com.au/~fobhm/animal_black.htm Friends of Black Hill and Morialta Conservations Parks Inc ...: ...(European) Rabbit, Oryctolagus cuniculus. *Koala, Phascolarctos cinereus. Bush Rat, Rattus fuscipes greyii. Brown Rat (Sewer Rat or Norway Rat), Rattus norvegicus. ... http://www.il-st-acad-sci.org/mammals/murids001.html MURINAE: Rattus chrysophilus. Rattus colletti. Rattus doboensis. Rattus flavipectus. Rattus fuscipes. Rattus giluwensis. Rattus hainaldi. Rattus hoxaensis. Rattus koratensis. ... http://www.geocities.com/liveattentively/jim.html A Timeline for the Upper Blue Mountains, for Mountain Plateau ...: MAMMALS: Greater Gliders born in April. Bush Rats, Rattus fuscipes born (March-May), numbers peak in May, many juveniles present. ... http://members.iinet.net.au/~foconnor/mammals/mammals.htm Western Australian Mammal Species: Pseudomys shortridgei, Heath Mouse, Dayang. Pseudomys australis, Plains Mouse, Rattus fuscipes fuscipes, Bush Rat, Rattus exulans §, Pacific Rat §, Polynesian Rat §. ... http://members.iinet.net.au/~foconnor/mammals/mammals_06.htm WA Mammals 06. Grassland Melomys to Lesser Stick-nest Rat: Bush Rat. Rattus fuscipes. Found in coastal areas from Jurien Bay to Israelite Bay. About fifty trapped in the Fitzgerald River National Park in May 2004. ... http://www.michaelmorcombe.com.au/dibblerstory.html AUSTRALIAN MARSUPIAL: The Dibblerfound after 83 years.: ...flowers. On the morning of the 26th the sole occupant of the traps was a Rattus fuscipes, caught on a flower five feet above ground. ... http://members.tripod.com/~Nager/dic4.htm Rodent Dictionary: Norway rat, common rat, brown rat, Rattus norvegicus, Wanderratte, Rat d'égout, Surmulot. Bush rat, Rattus fuscipes, Australische Buschratte, ---. ... http://members.tripod.com/~Nager/dic4a.htm Rodent Dictionary: Norway rat, common rat, brown rat, Rattus norvegicus, Bruine rat. Bush rat, Rattus fuscipes, ---. House mouse, Mus musculus ssp. Huismuis. ... http://www.antdiv.gov.au/default.asp?casid=2163 Australian Antarctic Division - Director AAD: Press, AJ 1988 Comparison of the demography of populations of Rattus fuscipes living in cool temperate rainforests and dry sclerophyll forests. Aust. WildI. ... http://www.mtbuller.com.au/environment/fauna.html Mt Buller - Environment - Fauna: Antechinus(Antechinus stuartii) and Dusky Antechinus (Antechinus swainsonii),Common Wombats (Vombatus ursinus), Bush Rats (Rattus fuscipes),Wallabies, Gliders ... http://www.itis.usda.gov/servlet/SingleRpt/SingleRpt?search_topic=TSN&search_value=180361 ITIS Standard Report Page: Rattus: Species, Rattus feliceus Thomas, 1920, Species, Rattus foramineus Sody, 1941, Species, Rattus fuscipes (Waterhouse, 1839), Species, Rattus giluwensis Hill, 1960, ... http://www.adventurecharters.com.au/vertidata_mm.htm Adventure Charters of Kangaroo Island - Vertebrates Database: Rodents, Mus domesticus, House Mouse* (C), L. Rattus fuscipes, Bush Rat (C), L. Rattus lutreolus, Swamp Rat (U), L. Rattus norvegicus, Brown Rat* (U), L. ... http://pubs.nrc-cnrc.gc.ca/cgi-bin/rp/rp2_abst_e?cjz_z00-110_78_ns_nf_cjz10-00 NRC Research Press: Canadian Journal of Zoology: Seven weeks of food supplementation caused numerical increases of 4.0- and 5.0-fold for the rodents Rattus fuscipes and Rattus lutreolus, respectively. ... http://home.vicnet.net.au/~donvrac/books.htm Bibliography: Date, Author, Title, Publisher, Catalogue. Hall SW, Habitat & resource use by small mammals--Antechinus stuartii ,A swansonii & Rattus fuscipes, ... http://home.vicnet.net.au/~mrcs/news.htm Macedon Range Conservation Society - News: Macedon. Some of us on the committee feel that the bush rat, Rattus fuscipes is so cute that it would make a fantastic pet I couldn't be persuaded to have a ... http://rainforest-australia.com/Native%20Mammal%20List.htm ! Tablelands Native Mammal List ! Tropical Rainforest, North ...: Grassland Melomys, Melomys burtoni, A. Giant White-tailed Rat, Uromys caudimaculatus, C. Bush Rat, Rattus fuscipes, C. Canefield Rat, Rattus sordidus, A. ... http://www.ebi.ac.uk/parasites/EGN/BLASTS/BLAST-AI676341.html BLAST data for AI676341: ...emb|L49368|HSMAJOPEA, Homo sapiens Machado-Joseph diseas... 245, 3.3e-10, 1. emb|AF110751|AF110751, Rattus fuscipes greyii clone RfgG1... 246, 5.1e-10, 1. ... http://www.ebi.ac.uk/parasites/EGN/BLASTS/BLAST-AI759593.html BLAST data for AI759593: 133, 1.3e-08, 3. emb|L49359|HSHUNTPEA, Sequence 12 from patent WO 9000403. 133, 1.3e-08, 3. emb|AF110751|AF110751, Rattus fuscipes greyii clone RfgG1... 139, 3.6e-08, 3. ... http://www.paperlinxethical.shares.green.net.au/fauna.htm Paperlinx Green Shareholders' Group - Native Animals: Vombatus ursinus Common Wombat; Rattus fuscipes Bush Rat; Mastacomys fuscus Broad-toothed Rat. Species recorded in 1996/97 from analysis ... http://www.unipv.it/webbio/dbagsg.htm DBA MAMMALIAN GENOME SIZE DATABASE: ...- ... Rattus tunneyi, RODENTIA, 0.00, 42, 1983, Baverstock. Rattus fuscipes, RODENTIA, 0.00, 38, 1983, Baverstock. Rattus leucopus cooktownensis, RODENTIA, 0.00, 36, 1983, Baverstock. ... http://ozland.angelnco.com/learn/wadwildlife.html Wadalba Fauna: Little Forest Bat, Vespadelus vultumus. Swamp Rat, Rattus lutreolus. Bush Rat, Rattus fuscipes. * Black Rat, Rattus rattus. * Brown Hare, Lepus capensis. ... http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Retrieve&list_uids=10447876&dopt=Citation Isolation and characterization of microsatellite loci from the ...: Click here to read Isolation and characterization of microsatellite loci from the bush rat, Rattus fuscipes greyii. Hinten G, Maguire ... http://www.museum.vic.gov.au/bioinformatics/mammals/images/thumbplac.htm Australia Victoria - Mammals, Victorian Mammal, Images, Database: Broad-toothed Rat Mastacomys fuscus, Broad-toothed Rat, Broad-toothed Rat, Broad-toothed Rat. Bush Rat Rattus fuscipes, Bush Rat, Bush Rat, Bush Rat. ... http://www.museum.vic.gov.au/bioinformatics/mammals/images/thumblplac.htm Australia Victoria - Mammals, Victorian Mammal, Images, Database: Broad-toothed Rat. Bush Rat Rattus fuscipes, Bush Rat, Bush Rat, Bush Rat. Bush Rat, Bush Rat, Bush Rat. Swamp Rat Rattus lutreolis, Swamp Rat, Swamp Rat, Swamp Rat. ... http://www.ffp.csiro.au/nfm/mdp/video/vid_ver1.htm Video Data - Habitat Structure: The two species of small mammals of interest to this study were the brown antechinus (Antechinus stuartii) and the bush rat (Rattus fuscipes). ... http://www.bluep.com/~oco/Mammals2000.txt LAWRIE'S LIFE LIST OF AUSTRALIAN MAMMALS 27/9/2000 Platypus ...: ...higginsi New Holland Mouse Pseudomys novaehollandiae Hastings River Mouse Pseudomys oralis Heath Rat Pseudomys shortridgei Bush Rat Rattus fuscipes Swamp Rat ... http://cimbad.mnhn.fr/mnhn/bpph/Equipes/Durettedesset/Publicationsdurettedesset.html Marie-Claude Durette-Desset: Publications: ...- ... BEVERIDGE et MC DURETTE-DESSET.- Distribution of species of Trichostrongyloid nematodes parasites in the small intestine of the bush rat, Rattus fuscipes Trans ... http://www.lib.monash.edu/resourcelists/b/bio2051.html BIO2051 Plant and animal ecology (Clayton): P., Happold, DCD, and Bubela, TM (1990), "Diet of two sympatric Australian subalpine rodents, Mastacomys fuscus and Rattus fuscipes", Australian wildlife ... http://www.csu.edu.au/special/bushfire99/papers/tasker/ Small Mammal Diversity and Abundance in Relation to Fire and ...: ...and ungrazed forests, largely as a result of differences in the two dominant species, the Brown Antechinus Antechinus stuartii and Bush Rat Rattus fuscipes. ... http://agspsrv34.agric.wa.gov.au/agency/pubns/miscpubs/011_2002/appx3.htm 1080 Summary Information - Appendix 3: 0.85. 3.80. 20. 0.6. Rattus fuscipes (Min Tolerance) D. Southern Bush Rat. 0.145. 22.2. ... 1.07. 4.80. 20. 0.7. Rattus fuscipes (Max Tolerance) D. Southern Bush Rat. 0.145. 73.3. ... http://www.anu.edu.au/BoZo/staffandstudents/staffprofiles/peakall.html Rod Peakall Profile: R., Ruibal, M., and Lindenmayer, DB (2003) Spatial autocorrelation analysis offers new insights into gene flow in the Australian Bush Rat, Rattus fuscipes. ... http://www.amonline.net.au/factsheets/bush_rat.htm Bush Rat: Status Native rodent. Scientific name Rattus fuscipes. Copyright © Australian Museum, 2003 This page: http://www.amonline.net.au/factsheets/bush_rat.htm. ... http://animaldiversity.ummz.umich.edu/site/accounts/information/Rattus.html ADW: Rattus: Classification: Ceram rat). Species Rattus foramineus (hole rat). Species Rattus fuscipes (bush rat). Species Rattus giluwensis (Giluwe rat). Species ... http://users.tpg.com.au/users/frizzle/species/fauna.htm fauna: Mammals, Eastern Grey Kangaroo, Macropus giganteus, House Mouse #, Mus musculus, Bush Rat, Rattus fuscipes, Scats. Black Rat #, Rattus rattus, Scats. ... http://imgt.cines.fr/textes/IMGTrepertoire/Taxonomy/vertebrates/taxo.html IMGT Marie-Paule page: IMGT repertoire: Raja eglanteria, Clearnose skate. Raja erinacea (3), Little skate. Rattus fuscipes, Bush rat. Rattus leucopus, Mottle-tailed rat. Rattus norvegicus, Norway rat. ... http://coastalecotours.com.au/tour_ff.htm Koolewong Coastal EcoTours - Flora & Fauna: Stypandra glauca ). Local Native Fauna includes : Brown Bandicoot ( Isoodon macrourus ), Bush Rat ( Rattus fuscipes ). Swamp Rat ( Rattus ... http://users.wired.net.au/susan/gipps.htm Gippsland: The most common mammals trapped were Agile Antechinus Antechinus agilis and Bush Rat Rattus fuscipes while others species recorded included White-footed ... http://www.culture-of-peace.info/muroid/references-38.html Motivational Systems in Muroid Rodents: Chicago: University of Chicago Press. Barnett SA, Stewart AP (1975): Audible signals during intolerant behavior of Rattus fuscipes. ... http://taxon.molgen.mpg.de/gettaxon?taxid=10114 TAXON Query Form: ...species: Rattus sp. (TaxID 10118, info); species: Rattus fuscipes (TaxID 10119, subtree, info): subspecies: Rattus fuscipes greyii (TaxID 89809, info); ... http://bioinfo.hku.hk/db/imgt/IMGT/relnotes.html IMGT/LIGM relnotes: 1 120 Pagrus major 1 1018 Papio anubis 1 283 Peromyscus maniculatus 1 474 Presbytis comata 1 361 Presbytis femoralis 1 361 Rattus fuscipes 1 1161 Rattus ... http://bioinfo.hku.hk/db/trembl/SPTRfasta/rem.seq rem|AAA86417|AAA86417 T CELL SURFACE GLYCOPROTEIN CD6. ...: GKGLEWLGMIWGDGSTDYNSALKSRLSISKDNSQSQVFLKMNSLQTDDTARYYCARAYYR YDWFAYWGQGTLVTVSA >rem|AAA41403|AAA41403 RAT (RATTUS FUSCIPES CORICUS) GERMLINE KAPPA L-CHAIN C ... http://homepages.picknowl.com.au/peters/Fauna.html Fauna of Scott Creek: Rodents : Two native rodents residing in the park, the Southern Bush Rat (Rattus fuscipes greyii) and the Golden Water Rat (Hydromys chrysogaster). ... http://www.publish.csiro.au/nid/90/paper/ZO03040.htm CSIRO PUBLISHING - Australian Journal of Zoology: Rattus fuscipes, and species of Pseudomys from populations with exposure to this vegetation, were particularly tolerant to fluoroacetate. ... http://www.bio.usyd.edu.au/SOBS/TEACHING/ecol/Mammalid.htm RECOGNISING DIFFERENT SMALL MAMMALS IN THE FIELD: Bush Rat Rattus fuscipes. Mosaic-tailed Rat Melomys cervinipes. Hastings River Mouse Pseudomys oralis. ... Bush Rat Rattus fuscipes. Length of head & body: 111-214mm. ... http://www.bio.usyd.edu.au/hochuli/slassaupast.htm Dieter Hochuli: Effects of road type were evident during at least one trapping period for both Antechinus stuartii and Rattus fuscipes, significantly greater abundances of ... http://www.davidbeniuk.com/infotainment2000.html davidbeniuk.com: Infotainment Lifestyle Album" • Buy This Album • Lyrics 1. Fish in the Sea 2. North Shore Girls Get Off 3. A Book That Sells 4. Rattus Fuscipes 5. Chinese ... http://www.barringtonguesthouse.com.au/bghmamms.htm Barrington Guest House - Mammals: Southern Bush Rat, Rattus fuscipes Throughout the park in sub-alpine woodland, sclerophyll forests, warm and cool temperate rainforests. ... http://www.nor.com.au/environment/clarencecatchment/mammals.htm mammals: ...sand). However, it is threatened by too-frequent control burning and habitat destruction. Bush Rat (Rattus fuscipes assimilis). Habitat ... http://www.sanger.ac.uk/HGP/Chr22/Mouse/Blastn/Em:U20225.dna.blastn.html NCBI BLAST Search Results: 188 4e-45 gi|5070518|gb|AF145112.1|AF145112 Rattus fuscipes assimilis... 188 4e-45 gi|5070516|gb|AF145110.1|AF145110 Rattus fuscipes coracius ... ... http://www.lisp.com.au/~ausbush/mammals.htm Aussie Bushabout Holidays - Amphibians: Common Ringtailed Possum. Pteropus poliocephalus. Grey-headed Flying-fox. Rattus fuscipes. Bush Rat. Rattus lutreolus. Swamp Rat. Rattus rattus. Black Rat. ... http://www.communitywebs.org/ScientificExpeditionGroup/pages/MinPic.htm Scientific Expedition Group - Minnawarra Photos: Duncan MacKenzie Setting a Cage Trap, Antichinus flavipes. Yellow Footed Antichinus. Rattus fuscipes. Bush Rat. Rattus lutreolus. Swamp Rat. ... http://www.latrobe.edu.au/wildlife/mammals.html La Trobe University - Wildlife: ...(short penis). Grey-headed Flying-fox, Pteropus poliocephalus. RODENTS, Water Rat, Hydromys chrysogaster, Bush Rat, Rattus fuscipes. Swamp Rat, Rattus lutreolus. ... http://anatomy.med.unsw.edu.au/cbl/embryo/DNA/Taxon/taxon_rat.htm Taxonomy (Rattus): Rattus. Back to DNA-Taxonomy Index. Parents: root. ... http://www.aias.org.au/resources/smrlists/liblist1.html AIAS: Other Resources: Publication Lists: SMR: Happold, David CD, Carron, PL and Tania M Bubela Diet of two sympatric Australian subalpine rodents, Mastacomys fuscus and Rattus fuscipes Australian Wildlife ... http://genstyle.imed.jussieu.fr/chaosgame/affichage_esp_list.php?lettres=r Alphabetical List of Species: Rattus evereti (1). Rattus exulans (19). Rattus flavipectus (12). Rattus fuscipes (2). Rattus leucopus (17). Rattus losea (5). Rattus moluccarius (11). ... http://www.earthfoot.org/places/au009b.htm Mammals around Cairns: 44, Grassland Melomys, Melomys burtoni. 45, Bush Rat, Rattus fuscipes. 46, Swamp Rat, Rattus lutreolus. 47, Spectacled Flying-fox (Fruit Bat), Pteropus conspicillatus. ... http://www.pcug.org.au/~glane/triplehfm/runstat.htm ACT Full Moon HHH - Run Statistics: SHITHEAD, SHITHEAD, 7, 51, 114. TWO DOGS FUCKING, VINCE HEFERNAN, 7, 1, 39. RATTUS FUSCIPES, NATHANIEL DAVIS, 7, 50, 131. LIKESA, LIKESA, 6, 100, 145. ... http://www.blackwellpublishing.com/issue.asp?ref=1442-9985&vid=22&iid=4&oc=aec02204&s=&site=1 Austral Ecology Issue: ...of the occurrence and diversity of hypogeal fungi in the diet of the long-nosed potoroo Potorous tridactylus and the bush rat Rattus fuscipes from south ... http://www.rzsnsw.org.au/Oct2003AZ.htm Australian Zoologist: Royal Zoological Society of New South Wales: ...domestic dogs? Responses of Rattus fuscipes and Antechinus stuartii - Peter .B. Banks, Nelika K. Hughes, and Tania A. Rose; Fauna ... http://www.rzsnsw.org.au/Newsletter4.htm RZS of NSW Newsletter No. 4: ...the most common being two possums (Trichosurus vulpecula and Pseudocheirus peregrinus), two native rodents (Melomys cervinipes and Rattus fuscipes) and one ... http://www2b.abc.net.au/science/scribblygum/newposts/61/topic61403.shtm ABC Online Forum: The Bush Rat, Rattus fuscipes does not occur in Tasmania, but is widespread on the mainland. It is delightfully furry with long soft fur. ... http://wwwscience.murdoch.edu.au/conf/phytophthora/abstract-wed.html Phytophthora in Forests & Natural Ecosystems - Albany 2001: In heathlands, species such as Rattus lutreolus (Swamp Rat), Rattus fuscipes (Bush Rat), Antechinus agilis (Agile Antechinus) and Sminthopsis leucopus (White ... http://metz.une.edu.au/~krohde/ Prof. Klaus Rohde homepage: Ph D thesis. Champion, AC (1986). Ectoparasites of Antechinus stuartii and Rattus fuscipes at Petroi, NSW Hons thesis. Currie, D. (1990). ... http://www.scu.edu.au/research/grc/index.php?pid=80&cat=0&subcat= SCU Graduate Research College | Publications: 1991-Current: Isolation and characterisation of microsatellite loci from the bush rat, Rattus fuscipes greyii. Molecular Ecology, 8: 1351-1352. 160. ... http://www.esajournals.org/esaonline/?request=get-document&issn=0012-9658&volume=083&issue=05&page=1317 SPATIAL SCALE, SPECIES DIVERSITY, AND HABITAT STRUCTURE: SMALL ...: ...species bias on recapture estimates produced by the high degree of “trappability� of some species (eg, Melomys cervinipes or Rattus fuscipes) or highly ... http://www.deh.gov.au/biodiversity/abrs/online-resources/abif/fauna/afd/format.html Australian Biological Resources Study - Australian Faunal ...: Rattus colletti (Thomas, 1904) Rattus exulans (Peale, 1848) Rattus fuscipes (Waterhouse, 1839) Rattus leucopus (Gray, 1867) Rattus lutreolus (Gray, 1841 ... http://darwin.zoology.gla.ac.uk/~vsmith/gallery.html [an error occurred while processing this directive] Rattus fuscipes [an error occurred while processing this directive] 19333 Bush Rat Bush Rat Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |