|
|
Redunca fulvorufula - Mountain ReedbuckIUCN Status: Least ConcernIUCN Species Profile http://www.itis.usda.gov/servlet/SingleRpt/SingleRpt?search_topic=TSN&search_value=624991 ITIS Standard Report Page: Redunca: Direct Children: Species, Redunca arundinum (Boddaert, 1785) -- southern reedbuck, Species, Redunca fulvorufula (Afzelius, 1815) -- mountain reedbuck, ... http://www.ecotravel.co.za/Guides/Wildlife/Vertebrates/Mammals/Large/Mountain_Reedbuck.htm The Mountain Reedbuck - Redunca fulvorufula of Southern Africa: A Guide to the: Mountain Reedbuck - Redunca fulvorufula. Mountain Reedbuck are closely related to Reedbuck, but, unlike the Reedbuck ... http://www.jww.de/artikelbeitrag/artikelbeitrag_13444.html JAGEN WELTWEIT: Bergriedbock <i>Redunca fulvorufula</i> (Afzelius ...: ...- Praxistipps, - Trense. Bergriedbock Redunca fulvorufula (Afzelius, 1815). English: Mountain Reedbuck: French: Redunca de montagne; Afrikaans ... http://www.jww.de/artikelbeitrag/artikelbeitrag_13623.html JAGEN WELTWEIT: Das große Wildarten-Lexikon von Trense: ...- ... Menges, 1894) Bengalfuchs Vulpes bengalensis (Shaw, 1800) Bergnyala Tragelaphus buxtoni (Lydekker, 1910) Bergriedbock Redunca fulvorufula (Afzelius, 1815 ... http://www.krugerpark.co.za/search/_Redunca_Fulvorufula.html Kruger National Park | Accommodation, Maps, Safari, Tours, Camps ...: Kruger National Park safari | Accommodation, Maps, Safari, Tours, Camps, Bookings. Information on ' Redunca Fulvorufula'. 0 Record(s). ... http://www.krugerpark.co.za/africa_mountain_reedbuck.html Mountain Reedbuck: Latin Name : Redunca Fulvorufula Weight (Female) : 15 - 34 kg Weight (Male) : 24 - 36 kg Gestation Period : 8 months No of Young : 1 lamb Birth Weight : 3 kg ... http://www.omne-vivum.com/b/3596.htm genus Redunca- -: T" "Redunca fulvorufula species: Redunca fulvorufula. ... http://www.omne-vivum.com/animals-and-plants/r.htm Omne vivum - Clickable index - Letter R: Red-throated diver, Red-throated pipit, Red-wattled lapwing, Redunca. Redunca arundineum, Redunca arundinum, Redunca fulvorufula, Redunca redunca. ... http://www.funet.fi/pub/sci/bio/life/mammalia/artiodactyla/bovidae/redunca/ Redunca: Africa. See [About maps]. Redunca fulvorufula (Afzelius, 1815) fulvorufula (Afzelius, 1815); Nova Acta Reg. Soc. Sci. Upsala, 7: 250 ... http://212.187.155.84/wnv/Subdirectories_for_Search/SpeciesKingdoms/0Families_ACrM_Artiodactyla/Bovidae/Redunca/Redunca_fulvorufula/Redunca_fulvorufula.html Redunca fulvorufula - Mountain reedbuck (Species Link Page): SPECIES LINK PAGE. Redunca fulvorufula - Mountain reedbuck: Summary Information. Living Organisms / Animalia / Craniata / Mammalia ... http://www.gisbau.uniroma1.it/amd/amd217.html ARTIODACTYLA: Bovidae. Redunca fulvorufula. (Afzelius, 1815). ... J.: 15, 289-294. Irby LR (1979). Reproduction in mountain reedbuck (Redunca fulvorufula). Mammalia: 43, 190-213. ... http://www.gisbau.uniroma1.it/amd/redunca.html species of Redunca: ...- ... Hippotragus Oryx Pelea Kobus Redunca: Redunca arundinum. Redunca fulvorufula. Redunca redunca. Pholidota, Rodentia. Lagomorpha, Macroscelidae. http://timeweb.wisdomtools.com/dbt/site34867.html Die Kelders Cave: Redunca arundinum, Redunca arundinum, Redunca arundinum, Redunca fulvorufula, Redunca fulvorufula, Redunca fulvorufula, Rhinocerotidae sp. Rhinocerotidae sp. ... http://www.highbeam.com/library/search.asp?FN=AO&refid=ency_refd&search_thesaurus=on&refid=ency_refd&q=reedbuck HighBeam Research: eLibrary Search: Results: The reedbucks (genus Redunca ), whose different species ... cm) high; the smallest, the mountain reedbuck ( Redunca fulvorufula ), is found in ... ... http://www.fact-index.com/g/gr/grazing_antelope.html Grazing antelope: ...in 2 genera; Subfamily Hippotraginae: Tribe Reduncini: Southern Reedbuck, Redunca arundinum; Mountain Reedbuck, Redunca fulvorufula; ... http://www.chez.com/monamiph/afsud94.htm Liste naturaliste afrique du sud 1994: ...- ... castle, Golden gate; Redunca fulvorufula Afzelius Redunca de montagne Krüger, Giant castle, Golden gate. Redunca arundinorum Boddaert ... http://home.wanadoo.nl/lionsite/ingestuurde_werkstukken.htm ingestuurde werkstukken: ...twee geslachten: waterbokken en het geslacht rietbokken (Redunca), omvattend drie Afrikaanse antilopen, de bergrietbok (Redunca fulvorufula), de bohorrietbok ... http://www.world-of-animals.de/tierlexikon/tierart_Riedbock.html World of Animals - Riedbock: ...- ... 3. Bergriedbock (Redunca fulvorufula); Widerristhöhe 70 cm, Gewicht 30 kg; das Fell ist lang und grau-gelbbraun gefärbt; die Hörner sind kurz und nach vorn ... http://www.interaktv.com/mammals/TubuliArt.html Biologybase: Mammals of the World: Tubulidentata through ...: Kobus megaceros. Kobus vardonii. Redunca arundinum. Redunca fulvorufula. Redunca redunca. Pholidota, Manidae, Manis crassicaudata. Manis gigantea. Manis javanica. ... http://www.vulkaner.no/n/africa/antilope.html Vår vidunderlige verden: Antiloper: Redunca arundinum Reedbuck Stor rørbukk. Redunca fulvorufula Mountain reedbuck Fjellrørbukk. Rhynchotragus sp Dvergantilope. Tragelaphus ... http://www.up.ac.za/academic/veterinary/depts_wild_projects.htm Departments - Wildlife Unit - Projects: Productivity of mountain reedbuck (Redunca fulvorufula) and grey rhebok (Pelea capreolus) in marginal habitat: A contribution to community upliftment. ... http://www.up.ac.za/academic/veterinary/depts_wild_pers.htm Departments - Wildlife Unit - Personnel: Productivity of mountain reedbuck (Redunca fulvorufula) and grey rhebok (Pelea capreolus) in marginal habitat: A contribution to community upliftment; ... http://www.staff.ncl.ac.uk/craig.roberts/rdbkterr.htm Dr Craig Roberts:: Territory quality in mountain reedbuck (Redunca fulvorufula chanleri): distance to safety. Robin IM Dunbar & S. Craig Roberts. Ethology 90, 134-142 (1992). ... http://www.staff.ncl.ac.uk/craig.roberts/papers.htm Dr Craig Roberts:: Dunbar RIM & Roberts SC. 1992. Territory quality in mountain reedbuck (Redunca fulvorufula chanleri): distance to safety. Ethology 90, 134-142. [abstract]. ... http://www.nelsonmandelabaytours.com/mountainzebra.htm The Mountain Zebra National Park: Kudu. Tragelaphus strepsiceros. Mountain reedbuck. Redunca fulvorufula. Red hartebeest. Redunca fulvorufula. Black wildebeest. Connochaetes gnou. Blesbok. ... http://www.faunistik.net/BSWT/MAMMALIA/UNGULATA/BOVIDAE/bovidae.html Mammalia: Bovidae - Rinderartige: ...- ... Großer Riedbock - Redunca arundium. Riedbock - Redunca redunca. Bergriedbock - Redunca fulvorufula. Rehantilope - Pelea capreolus. Pferdeböcke - Hippotraginae. ... http://www.masai-mara.com/mmscx.htm Order: Nile Lechwe. Kobus vardonii. Puku. Redunca arundinum. Common Reedbuck. Redunca fulvorufula. Mountain Reedbuck. Redunca redunca. Bohor Reedbuck. Tragelaphinae. (Several). ... http://www.press.jhu.edu/books/walkers_mammals_of_the_world/artiodactyla/images/image.artiodactyla.bovidae.redunca.html Thumbnails Page, Artiodactyla Bovidae Redunca: Artiodactyla Bovidae Redunca (Click on thumbnail to view larger image). Reedbuck (Redunca fulvorufula), photo from New York Zoological Society. ... http://www.press.jhu.edu/books/walkers_mammals_of_the_world/artiodactyla/images/image.mid.artiodactyla.bovidae.redunca.fulvorufula.1.html Image Page, Artiodactyla Bovidae Redunca: Artiodactyla Bovidae Redunca. Reedbuck (Redunca fulvorufula), photo from New York Zoological Society. Return to Genus Copyright © 1997 ... http://robetta.bakerlab.org/taxonomy.jsp?id=909 Robetta Server Job 909 NR PSI-Blast Taxonomy Results: ...moschatus]. 59555, Redunca fulvorufula, 2 (1.5%), 2E-35, 10-99, 1-90, 148, 97, 90, gb|AAK67750.1|, kappa-casein [Redunca fulvorufula]. 59531, ... http://robetta.bakerlab.org/taxonomy.jsp?id=910 Robetta Server Job 910 NR PSI-Blast Taxonomy Results: ...gen. sp.]. 59555, Redunca fulvorufula, 2 (1.44%), 3E-52, 38-171, 1-132, 205, 91, 134, gb|AAM75110.1|, kappa casein [Redunca fulvorufula]. 9755, ... http://mitglied.lycos.de/fischenjagen/wild.htm Wild: ...- ... Riedbock (Redunca redunca); Bergriedbock (Redunca fulvorufula); Rehantilope (Pelea capreolus). U.fam: Gazellenartige (Antilopinae), Art: Gazelle. U.fam. ... http://www.encyclopedia.com/html/m1/marshant.asp marsh antelope on Encyclopedia.com: ...in. (76 cm) high; the smallest, the mountain reedbuck ( Redunca fulvorufula ), is found in the hills and mountains of E Africa. ... http://www.kwiktan.com/taxidermy.htm Taxidermy: Raphicerus Melanotis). Cape Bushbuck (Tragelaphus Scriptus), Mountain Reedbuck (Redunca Fulvorufula), Vall Rhebok (Pelea Capreolus). Mountain ... http://www.bioproject.info/Subclass_Placental_mammals/Order_even-toed_ungulates/Ruminats/Antelope/Types_of_antelope/Reedbucks_waterbucks_and_their_relatives.html Reedbucks, waterbucks, and their relatives : Types of antelope ...: The bohor reedbuck is classified as Redunca redunca, the southern or common reedbuck as Redunca arundinum, and the mountain reedbuck as Redunca fulvorufula. ... http://www.factmonster.com/ce6/sci/A0831966.html marsh antelope: ...in. (76 cm) high; the smallest, the mountain reedbuck (Redunca fulvorufula), is found in the hills and mountains of E Africa. The ... http://www.nws-wiesbaden.de/samm030.html Museum Wiesbaden - Naturwissenschaftliche Sammlung: Sammlungen ...: ...- ... Dickhornschaf]; Bovidae: Raphicerus campestris (Thunberg) [Steinböckchen]; Bovidae: Redunca fulvorufula (Afzelius) [Bergriedbock]; Bovidae ... http://61.9.197.64/savuti/hunting_price.htm Pricelist: 1,200.00, Reedbuck - common, Redunca arundinum, US$, on request, Reedbuck - mountain, Redunca fulvorufula, US$, on request, Rhinoceros- white, ... http://61.9.197.64/savuti/mtreedbuck.htm Mountain Rhebuck: Mountain Reedbuck (Redunca fulvorufula). Size, Smaller than an Antelope. Weight, 50 – 60 lb (23 - 27kg). Shoulder height, 24 – 30’’ (61 - 76cm). ... http://www.ultimatefieldguide.com/100Species.htm 100 Species: Reedbuck - Redunca arundinum. Mountain Reedbuck - Redunca fulvorufula. Grey Rheebuck- Pelea capreolus. Springbuck - Antidorcas marsupialis. ... http://perso.club-internet.fr/boudetjo/ZooList/Mammif/ClasArti.html Classification des Artiodactyles: ...- ... REDUNCINAE, Kobus Redunca, Kobus ellipsiprymnus Kobus kob Kobus leche Kobus megaceros Kobus vardonii Redunca arundinum Redunca fulvorufula Redunca redunca. ... http://it.wikipedia.org/wiki/Serengeti_National_Park Serengeti National Park - Wikipedia: ...- ... Oreotragus oreotragus; Gasella thomsonii; Gazella granti; Redunca fulvorufula; Redunca redunca; Kobus ellipsiprymnus defassa; Hippotragus ... http://www.geocities.com/Vila_luisa/Fauna_Especies.htm Espécies mais Representativas: ...- ... oreotragus Raphicerus melanotis Cephalophus natalensis Felis caracal Canis mesomelas Canis adustus Redunca arundinum Redunca fulvorufula Acinonyx jubatus ... http://www.zoovienna.at/old/tierliste2000.html Tierbestandsliste vom Dezember 2000: ...- ... Rentier, Reindeer, Rangifer tarandus. Bergriedbock, Mountain reedbuck, Redunca fulvorufula. Minischwein, Minipig, Sus scrofa f. domestica. ... http://www.serengeti.org/animals.html Serengeti - Animals: Reedbuck and allies. Mountain Reedbuck Redunca fulvorufula. Bohor Reedbuck Redunca redunca. Defassa Waterbuck Kobus ellipsiprymnus defassa. Horse-like Antelopes. ... http://www.serengeti.org/deutsch_neu/animals.html Serengeti - Tiere: ...- ... Grantgazelle Gazella granti. Riedböcke und Verwandte. Bergriedbock Redunca fulvorufula. Riedbock Redunca redunca. Defassa-Wasserbock Kobus ellipsiprymnus defassa. ... http://bnhm.berkeley.museum/browse/vertebrates_Mammalia_Artiodactyla_Bovidae_Redunca_all.php?ViewResults=vertebrates_Mammalia_Artiodactyla_Bovidae_Redunca_all Berkeley Natural History Museums: 1) view specimens Redunca arundium (Unspecified) (3) view specimens Redunca darti (Unspecified) (1) view specimens Redunca fulvorufula (Unspecified) (16) view ... http://www.sntc.org.sz/checklst/mamamch.html Mammals Checklist - Malolotja Nature Reserve, Swaziland: ...ourebi Aepycerotinae Aepyceros melampus Peleinae Pelea capreolis Bovinae Tragelaphus scriptus Reduncinae Redunca arundinum Redunca fulvorufula, Shrews, elephant ... http://www.sntc.org.sz/checklst/sdmamchk.html Swaziland National Trust Commission - Swaziland's Fauna: ...scriptus Tragelaphus strepsiceros Taurotragus oryx Cephalophus natalensis Sylvicapra grimmia Redunca arundinum Redunca fulvorufula Kobus ellipsiprymnus ... http://www.netnatur.dk/bruger/side_vis.pl/site=netnatur&omraade=Netjagt/Jagt%20i%20udlandet/Arkiv/&side=reedbuck&state=side_bruger_vis reedbuck: ...image.dk. (Redunca fulvorufula fulvorufula) lever i bjergområder i Sydafrika, Mozambique og det sydlige Botswana. Gennemsnitsvægten ... http://www.esapubs.org/archive/ecol/E084/094/MOMv3.3.txt AF extant Artiodactyla Bovidae Addax nasomaculatus 4.85 70000.3 60 ...: ...- ... 3.98 9499.9 "63, 70" AF extant Artiodactyla Bovidae Redunca arundinum 4.76 58000.3 "63, 70" AF extant Artiodactyla Bovidae Redunca fulvorufula 4.47 29499.9 "63 ... http://www.esapubs.org/archive/ecol/E084/093/Mammal_lifehistories_v2.txt order family Genus species mass(g) gestation(mo) newborn(g) ...: Bovidae Redunca redunca 40000.00 7.50 -999.00 -999.00 -999.00 120.00 216 1.00 -999.00 "1,2,13,16" Artiodactyla Bovidae Redunca fulvorufula 30000.00 7.57 ... http://www.sagarmatha.com/galleries/Kenya/Kenya2.html 1999 Africa Trip: Back to Kenya: While waiting for the sun to set, I met up with another birder, and we saw mountain reedbucks (Redunca fulvorufula), lesser blue-eared starlings (Lamprotornis ... http://www.wildlifesafari.info/reedbuck_mountain.html Mountain Reedbuck | African Animals | Antelope | Wildlife Safari. ...: Mountain Reedbuck - Redunca fulvorufula. SIZE: Shoulder height (m) 0,8 m, (f) 0,7 m; mass (m) 30 kg, (f) 28 kg. Only males have the ... http://library.wur.nl/wda/abstracts/ab3235.html Summary/Abstract, WU dissertation no. 3235: ...warthog (Phacocoerus aethiopicus), Burchell’s zebra (Equus burchelli), eland (Taurotragus oryx), Chanler’s reedbuck (Redunca fulvorufula chanleri), and ... http://www.icon.co.za/~webotha/prices.htm Prices: 1650. Common Reedbuck. Rietbok. Redunca arundinum. 550. Mountain reedbuck. Rooiribbok. Redunca fulvorufula. 300. Waterbuck. Waterbok. Kobus ellipsiprymnus. 1600. Red lechwe. ... http://www.capehuntsafaris.co.za/ Cape Hunt Safari's - Trophy Hunting for the Discerning Hunter!: Blesbok - Damaliscus dorcas phillipsi Bontebok- Domaliscus dorcas dorcas Reedbuck - Redunca arundinum Mountain Reedbuck - Redunca fulvorufula Grey Rheebuck ... http://elib.cs.berkeley.edu/photos/fauna/sci-Mammal.html CalPhotos: Browse Mammal Scientific Names: ...tarandus ssp. platyrhynschus (3) Rattus norvegicus (2) Redunca fulvorufula (1) Redunca redunca (4) Redunca sp. (1) Reithrodontomys ... http://www.routes.co.za/nature/ecoregions/drakensberg.html Routes Travel Info Portal: Drakensberg lower regions - Drakensberg ...: ...in southern Africa are found here: eland (Taurotragus oryx); reedbuck (Redunca arundinum); mountain reedbuck (Redunca fulvorufula); ... http://www.routes.co.za/nature/ecoregions/drakensberghigh.html Routes Travel Info Portal: Drakensberg mountains higher than 2' ...: TOP. Mammals. Mammals are mostly ungulates (ie hoofed): klipspringer (Oreotragus oreotragus); mountain reedbuck (Redunca fulvorufula); eland (Taurotragus oryx); ... http://www.nebulasearch.com/encyclopedia/article/Grazing_antelope.html Grazing antelope: Subfamily Hippotraginae; Tribe Reduncini; Southern Reedbuck, Redunca arundinum; Mountain Reedbuck, Redunca fulvorufula; Bohor Reedbuck ... http://www.wta.org.za/info/animals.htm Game Species: Reedbuck, Common, Rietbok, Redunca arundinum, Artiodactyla, Bovidae, Reduncinae. Reedbuck, Mountain, Rooiribbok, Redunca fulvorufula, Artiodactyla, Bovidae, Reduncinae. ... http://home.no.net/trohi/mammalia/artiodactyla/bovidae.html bovidae.html: ..., Redunca arundinum, Stor rørbukk=Reedbuck. ", Redunca fulvorufula, Fjellrørbukk=Mountain reedbook. ", Redunca redunca, Bohorrørbukk=Bohar reedbuck. ... http://zebrarug.com/skullmntgallery3_640.htm Zebra Rugs,Skulls,Animal Bones, Skull Mounts & Animal Skin Rugs ...: Mountain Reedbuck Skull Mount Redunca Fulvorufula, Porcupine Skull Mount Hystrix Africaeaustralis, Red Hartebeest Skull Mount Alcelaphus Caama, Springbok Skull ... http://zebrarug.com/zoom/mountain_reedbuck_640.htm Animal Bones, Skull Mounts & Animal Skin Rugs - Wildlife Etc.: Description: Mountain Reedbuck Skull Mount Scientific Name: Redunca Fulvorufula. Price: $44.00 - $135.00. Contact us for more information: sales@zebrarug.com. ... http://www.sabie.co.za/about/natural_heritage.html Natural Heritage - Sabie: 8) above the Kloof mountain reedbuck (Redunca fulvorufula) and small numbers of the vulnerable oribi (Ourebia ourebia) can be found with klipspringer ... http://www.nbi.ac.za/freestate/animals.htm NBI:Mammals in the Free State NBG: Steenbok Raphicerus campestris Steenbok, Common duiker Sylvicapra grimmia Duiker, Mountain reedbuck Redunca fulvorufula Rooiribbok, ??Lion ??Panthera leo ??Leeu, ... http://www.nbi.ac.za/sisulu/checklists.htm NBI:Wildlife checklists for Walter Sisulu NBG: ...aardvark) Orycteropus afer S290 Rock dassie/rock hyrax Procavia capensis S313 Common duiker Sylvicapra grimmia S335 Mountain reedbuck Redunca fulvorufula. ... http://www.greatlimpopopark.com/main.php?main_item=1&nav_id=4&name=Wildlife%20in%20the%20GLTP&pos= Great Limpopo Transfrontier Park :: Wildlife in the GLTP: ...eland, nyala Tragelaphus angasii, bushbuck Tragelaphus scriptus, roan, sable, tsessebe, steenbok, mountain reedbuck Redunca fulvorufula, Sharpe's grysbok ... http://www.africatrophyhunting.com/TrophyRoom.asp?PageStack=%2FTrophies.asp%3Ff%3D4&Id=9 Africa Trophy Hunting :: Thormahlen and Cochran Classic African ...: Client: Southern Mountain Reedbuck. Species: Redunca fulvorufula fulvorufula. Region: RSA. Client: Arb Evans. Species: Mountain Reedbuck-excellent trophy. ... http://www.biologie.uni-hamburg.de/b-online/afrika/wcmc/ngorongoro.htm IUCN Management Category: On the crater rim are buffalo Syncerus caffer, elephant Loxodonta africana (V), mountain reedbuck Redunca fulvorufula and leopard Panthera pardus (T ... http://www.scienceinafrica.co.za/2004/january/caracal.htm Controlling the caracal: ...than itself. Large rams of Mountain Ribbok (Redunca fulvorufula), with a mass of 35kg are easily killed by the caracal. They feed ... http://www.laikipia.org/hotel_lolldaiga-hills.htm Laikipia Wildlife Forum - Hotels and Lodges - Lolldaiga Hills: ...melampus Gerenuk Litocranius walleri Bushbuck Tragelaphus scriptus Bohor reedbuck Redunca redunca Mountain reedbuck Redunca fulvorufula Warthog Phacochoerus ... http://www.nasmus.co.za/MAMMALS/COLLECTI.HTM collection: Pronolagus rupestris. Proteles cristatus. Top. Rattus rattus. Redunca fulvorufula. Rhabdomys pumilio. Rhinolophus clivosus. Rhinolophus darlingi. Rhinolophus denti. Top. ... http://www.bluewaterbiggame.com/game/african_southern_mountain_reedbuck.cfm Southern Mountain Reedbuck Hunting African Safaris and Rowland ...: ...safaris - 06-01-2004. Southern Mountain Reedbuck. (Redunca fulvorufula fulvorufula). Find an Outfitter by: Destination. ... http://www.bluewaterbiggame.com/game/african_chanler_mountain_reedbuck.cfm Chanler Mountain Reedbuck Hunting African Safaris and Rowland Ward ...: Chanler Mountain Reedbuck. (Redunca fulvorufula chanleri). Current all time records SCI: Score 15 4/8 - Kenya, Lolgorian - 10/67 Rowland Ward: Score 9 5/8 - Mt. ... http://www.viviun.com/AD-11228/ Farm/Ranch For Sale in Smithfield, Free State South Africa - Ideal ...: ...the area. There are about 50 Mountain Reedbuck (redunca fulvorufula) and 20-30 Steenbok (raphicerus campestris) on the farm. Also ... http://utne.nvg.org/g/bovidae.html Skrivarstuå: Fe (Bovidæ): Redunca arundinum (southern reedbuck); Redunca fulvorufula (mountain reedbuck); Redunca redunca (Bohar reedbuck). Kommentar. Kjelder / Sources. ... http://www.deer.rr.ualberta.ca/library/taxonomy/Artiodactyla.html Artiodactyla: Waterbuck Kobus kob - Kob Kobus leche - Lechwe Kobus megaceros Kobus vardonii - Puku Redunca arundinum - Reedbuck Redunca fulvorufula Redunca redunca - Common ... http://www.redtailcanyon.com/items/13679.aspx World Heritage Sites: Kilimanjaro National Park: ...leopard Panthera pardus, black rhinoceros Diceros bicornis (E) (probably now extinct in this area), mountain reedbuck Redunca fulvorufula and Kilimanjaro tree ... http://wildnetafrica.co.za/estate/capturecare/sectionb/b3_antelope/02_openshaw.html WildNet Africa - Capture and Care Manual - Mass capture of ...: Mountain reedbuck Redunca fulvorufula. The mountain reedbuck... •Is a gregarious animal, occurring in herds of up to 20 animals. ... http://www.inasp.info/ajol/journals/sajwr/vol33no2abs.html AJOL: South African Journal of Wildlife Research: Volume 33, Issue ...: Population sizes of reedbuck (Redunca arundinum), mountain reedbuck (Redunca fulvorufula), grey rhebuck (Pelea capreolus), and oribi (Ourebia ourebi) varied ... http://sege.ntu.edu.sg/cgi-bin/extract_info.pl?dbase=gbmam&field=protein&pop=69&type=1 Your Search Results: 734) , product("beta spectrin") VEDLLQKHALVEADIGIQAERVRGVNASAQKFATDGE{G}YKPCDPQVIRDRVAHMEFCYQELCQLAAERRAR > 54332_AF210205 Redunca fulvorufula beta spectrin ... http://www.sun.ac.za/academic/Natural/consumer_science/ResReport2003.htm Research Report: South Africa 2003. VAN SCHALKWYK S. Fatty acid analysis of mountain reedbuck (Redunca fulvorufula). South African Wildlife Management ... http://kapama.krugerpark.co.za/search/_Redunca_Fulvorufula.html Kapama Private Game Reserve | Greater Kruger Park Accommodation ...: Kapama Private Game Reserve | Greater Kruger Park | Bush hotel krugerpark. Information on ' Redunca Fulvorufula'. 0 Record(s). Kapama ... http://www.acts.co.za/meat_safety/Schedule.htm Schedule 1 Animals to which this Act Applies: Impala (Aepyceros melampus). Kudu (Tragelaphus stepsiceros). Mountain Reedbuck (Redunca fulvorufula). Springbuck (Antidorcas marsupialis). ... http://www.infobiogen.fr/db/embl-align/ALIGN_000489.dat [an error occurred while processing this directive] Redunca fulvorufula [an error occurred while processing this directive] 19391 Mountain Reedbuck Mountain Reedbuck Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |