|
|
Sminthopsis macroura - Stripe-Faced DunnartIUCN Status: Lower Risk/Least ConcernIUCN Species Profile http://www.itis.usda.gov/servlet/SingleRpt/SingleRpt?search_topic=TSN&search_value=552418 ITIS Standard Report Page: Sminthopsis: Species, Sminthopsis longicaudata Spencer, 1909, Species, Sminthopsis macroura (Gould, 1845), Species, Sminthopsis murina (Waterhouse, 1838), ... http://animaldiversity.ummz.umich.edu/site/accounts/information/Sminthopsis_macroura.html ADW: Sminthopsis macroura: Information: Sminthopsis macroura (stripe-faced dunnart). ... Family: Dasyuridae. Genus: Sminthopsis. Species: Sminthopsis macroura. Geographic Range. ... http://animaldiversity.ummz.umich.edu/site/accounts/specimens/Sminthopsis_macroura.html ADW: Sminthopsis macroura: Classification: Sminthopsis macroura (stripe-faced dunnart). ... stripe-faced dunnart Sminthopsis macroura, stripe-faced dunnart Sminthopsis macroura. ... http://members.iinet.net.au/~foconnor/mammals/species/sminthopsis_macroura.htm Stripe-faced Dunnart (Sminthopsis macroura): Stripe-faced Dunnart (Sminthopsis macroura). The following is a photograph of a Stripe-faced Dunnart trapped at the Argyle Diamond Mine in November 2000. ... http://members.iinet.net.au/~foconnor/mammals/mammals_02.htm WA Mammals 02. Yellow-footed Antechinus to Red-cheeked Dunnart: Stripe-faced Dunnart (photographs). Sminthopsis macroura. Several caught in pit and Elliott traps at the Argyle Diamond Mine. Two ... http://www.viridans.com/mampics/smamm.htm Mammal Images - S: Fat-tailed dunnart © Lindy Lumsden (1072bll1) Sminthopsis leucopus White-footed dunnart © Peter Robertson (1069apr1) Sminthopsis macroura Stripe-faced ... http://www.viridans.com/mampics/dmamm.htm Mammal Images - D: Tony Robinson (1071atr1) Dunnart; Sooty Sminthopsis aitkeni © Tony Robinson (1065atr1) Dunnart; Stripe-faced Sminthopsis macroura © Tony Robinson (1073atr1 ... http://www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=Sminthopsis+macroura+%5Bgbmam%5D Codon usage table: Sminthopsis macroura [gbmam]: 5 CDS's (964 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU 23.9( 23) UCU 20.7 ... http://www.zoology.unimelb.edu.au/staff/hickford.htm Dr.Danielle Hickford, Research Fellow,Department of Zoology: My project examined several aspects of gastrulation (formation of the three primary body layers) in the marsupial Sminthopsis macroura, the stripe-faced dunnart ... http://www.zoology.unimelb.edu.au/staff/selwood.htm Prof Lynne Selwood, Professorial Fellow, Department of Zoology: Cruz, Y., Yousef, A. and Selwood, L. (1996). Fate map analysis of the epiblast of the dasyurid marsupial, Sminthopsis macroura. Reprod. Fertil. Dev. 8, 779-88. ... http://www-dsv.cea.fr/thema/MitoPick/Search/Sminthopsis_macroura.html Result for Sminthopsis macroura: ...- Your specific search result is: name of the subunit. Family name/other name. gene localization. NU1M_SMIMA, ND1 subunit, Mitochondria. ... http://www-dsv.cea.fr/thema/MitoPick/MitoNUOList.html NUO 1.6.5.3: O78754, NULM_SHEEP Simulium vittatum P50659 NU1M_SIMVI P50660 NU4M_SIMVI Sminthopsis crassicaudata O78715, NU1M_SMICR Sminthopsis macroura O78712, NU1M_SMIMA ... http://www.damisela.com/zoo/mam/marsupialia/dasyuridae/nombres.htm Gatos Marsupiales: ...- ... Dunart de Cara Rayada, Strip-faced Dunnart, Sminthopsis macroura. Dunart de Cola Delgada, Slender-tailed Dunnart, Sminthopsis murina. ... http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Display&dopt=pubmed_pubmed&from_uid=14707400 Entrez PubMed: Abstract, Development of lymphoid tissues of the stripe-faced dunnart (Sminthopsis macroura). Cells Tissues Organs. 2003;175(4):192-201. ... http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&list_uids=14707400&dopt=Abstract Development of lymphoid tissues of the stripe-faced dunnart ...: Click here to read Development of lymphoid tissues of the stripe-faced dunnart (Sminthopsis macroura). Old JM, Selwood L, Deane EM. ... http://www.bluep.com/~oco/AMTC%20checklist.html The official AMTC checklist:: 51 Long-tailed Dunnart Sminthopsis longicaudata. 52 Stripe-faced Dunnart Sminthopsis macroura. 53 Common Dunnart Sminthopsis murina. ... http://www.bluep.com/~oco/Mammals2000.txt LAWRIE'S LIFE LIST OF AUSTRALIAN MAMMALS 27/9/2000 Platypus ...: ...harrisii Fat-tailed Dunnart Sminthopsis crassicaudata White-footed Dunnart Sminthopsis leucopus Stripe-faced Dunnart Sminthopsis macroura Common Dunnart ... http://genome.jgi-psf.org/cgi-bin/dispGeneModel.v4?db=whiterot1&id=95979 Protein Pages: Phanerochaete chrysosporium (White Rot fungus): Description: Best Hit: gi|4098582|gb|AAD00328.1| (U79567) RBM1 [Sminthopsis macroura] (model%: 100, hit%: 8, score: 85, %id: 51) [Sminthopsis macroura]. ... http://www.calm.wa.gov.au/science/mupdates.html Science Matters - Australian Mammal Map Updates: ...dasy4.zip, Sminthopsis hirtipes, Sminthopsis longicaudata, Sminthopsis macroura, Sminthopsis murina, Sminthopsis ooldea, Sminthopsis psammophila. ... http://www.australianmammals.org.au/species.htm Australian Mammal Species Files: Sminthopsis leucopus. Long-tailed Dunnart. Sminthopsis longicaudata. Stripe-faced Dunnart. Sminthopsis macroura. Common Dunnart. Sminthopsis murina. Common Dunnart. ... http://www.terrambiente.org/fauna/Mammiferi/metatheria/dasyuromorphia/ Dasiuromorfi: Sminthopsis griseoventer, Sminthopsis hirtipes, Sminthopsis laniger, Sminthopsis leucopus, Sminthopsis longicaudata, Sminthopsis macroura, Sminthopsis murina ... http://www.marsupialsociety.org/checklist.html Keeping Marsupials : Keeping and Breeding Marsupials in Captivity ...: Long-tailed Dunnart, Sminthopsis longicaudata. Stripe-faced Dunnart, Sminthopsis macroura. Common Dunnart. Sminthopsis murina. Ooldea Dunnart. Sminthopsis ooldea. ... http://www.ingenta.com/isis/searching/ExpandTOC/ingenta?issue=pubinfobike://els/0145305x/2004/00000028/00000004&index=7 Ingenta: Article Summary -- A developmental investigation of the ...: A developmental investigation of the liver, bone marrow and spleen of the stripe-faced dunnart (Sminthopsis macroura) Developmental and Comparative Immunology ... http://www.ingenta.com/isis/browsing/TOC/ingenta?issue=pubinfobike://els/0145305x/2004/00000028/00000004 Ingenta: Table of Contents -- Developmental and Comparative ...: 7. A developmental investigation of the liver, bone marrow and spleen of the stripe-faced dunnart (Sminthopsis macroura) Old JM; Selwood L.; Deane EM ... http://exon.bic.nus.edu.sg/~meena/sege/gb130/gbmam.output 1_AAMC1R DEFINITION Alces alces MC1-R gene. ORGANISM Ovibos ...: 29_AB011229 DEFINITION Sminthopsis macroura mitochondrial ND1 gene for NADH dehydrogenase subunit 1 , complete cds. ORGANISM Sminthopsis ... http://exon.bic.nus.edu.sg/~meena/sege/gb128/gbmam.101 14139_AAMC1R Alces alces MC1-R gene.!Nuclear !Orgn:Ovibos ...: 14167_AB011229 Sminthopsis macroura mitochondrial ND1 gene for NADH dehydrogenasesubunit 1 , complete cds.!Nuclear !Orgn:Sminthopsis macroura =nid(g3401928 ... http://www.ciencia.net/VerArticulo/?idTitulo=Dasyuridae Dasyuridae - Ciencia.net - Noticias cientÃficas, artÃculos ...: ...- ... lanudo Sminthopsis leucopus Ratón marsupial de pies blancos Sminthopsis longicaudata Ratón marsupial colilargo Sminthopsis macroura Ratón marsupial de cara ... http://perso.club-internet.fr/boudetjo/ZooList/Mammif/ClasMars.html Classification des Marsupiaux: Sminthopsis griseoventer Sminthopsis hirtipes Sminthopsis laniger Sminthopsis leucopus Sminthopsis longicaudata Sminthopsis macroura Sminthopsis murina ... http://home.t-online.de/home/irle.eifel/australia_mammals.html Irles Artenlisten - Australien - Säugetiere: Dasyuridae, Sminthopsis longicaudata, Spencer,1909, Long-tailed Dunnart. Dasyuridae, Sminthopsis macroura, (Gould,1845), Stripe-faced Dunnart. ... http://www.ivis.org/special_books/Heard/holz/chapter_frm.asp?LA=1 Restraint and Anesthesia of Dasyurids (Dasyuromorphia): Long-Tailed Dunnart, Sminthopsis longicaudata, 15 - 21 g, 15 - 21 g. Stripe-faced Dunnart, Sminthopsis macroura, 15 - 25 g, 15 - 25 g. Common ... http://www.publish.csiro.au/nid/90/paper/ZO97002.htm CSIRO PUBLISHING - Australian Journal of Zoology: Growth and Development of Pouch Young of the Stripe-faced Dunnart, Sminthopsis macroura (Marsupialia : Dasyuridae), in Captivity L. Frigo and PA Woolley ... http://www.nt.gov.au/ipe/pwcnt/index.cfm?attributes.fuseaction=open_page&page_id=3597 Mammals: Dunnart. Sminthopsis, longicaudata, Long-tailed Dunnart. Sminthopsis, macroura, Stripe-faced Dunnart. Sminthopsis, ooldea, Ooldea Dunnart. ... http://www.nt.gov.au/ipe/pwcnt/index.cfm?attributes.fuseaction=open_page&page_id=4367 Conservation status of animals of the Northern Territory: Sminthopsis hirtipes, Hairy-footed Dunnart. Sminthopsis macroura, Stripe-faced Dunnart. Sminthopsis ooldea, Ooldea Dunnart. Sminthopsis virginiae, Red-cheeked Dunnart. ... http://www.oberlin.edu/biology/faculty/cruz.html Biology: Selwood L (2000) A staging scheme for assessing development in vitro development of organogenesis-stage embryos of Sminthopsis macroura (Marsupialia: Dasyuridae ... http://www.savci.upol.cz/kunovci.htm Dasyuromorphia - Kunovci: Tjarrtjalaranpa, Yarntala, Yarrutju) Sminthopsis macroura (Gould, 1845) - vakomyÅ¡ tvářopruhá - Stripe-faced Dunnart (syn. Darling ... http://www.rickertweb.com/~justin/School/CS360%20Database%20Systems/PC2/SQL/2b.txt SQL> @c:\2b.sql NAME PRINTNAME ...: Sminthopsis griseoventer Sminthopsis laniger Sminthopsis leucopus Sminthopsis leucopus Sminthopsis leucopus Sminthopsis macroura Sminthopsis macroura ... http://www.rickertweb.com/~justin/School/CS360%20Database%20Systems/PC4/Data/SYNOM/MAM10SYN.txt PRINTNAME SYNON_NAME ORIG_NM AUTHOR CITATION NOTES Dasyuromorphia ...: ...laniger spenceri Sminthopsis leucopus ferruginifrons Sminthopsis leucopus leucogenys Sminthopsis leucopus mitchelli Sminthopsis macroura froggatti Sminthopsis ... http://www.reproduction-online.org/cgi/content/abstract/121/6/933 Reproduction -- Abstracts: Cruz et al. 121 (6): 933: Articles. Significance of serum early pregnancy factor concentrations during pregnancy and embryonic development in Sminthopsis macroura (Spencer) (Marsupialia ... http://www.reproduction-online.org/cgi/content/abstract/111/2/319 Reproduction -- Abstracts: Cruz and Selwood 111 (2): 319: Articles. Histological differences between gravid and non-gravid uteri in the dasyurid marsupial, Sminthopsis macroura (Spencer). YP Cruz and L Selwood. ... http://www.green.net.au/quoll/forests/phasco.html Tuft-tailed phascogale; a newly discovered species: Sminthopsis granulipes, Sminthopsis griseoventer, Sminthopsis hirtipes, Sminthopsis leucopus, Sminthopsis longicaudata, Sminthopsis macroura, Sminthopsis murina ... http://www.apus.ru/site.xp/055054050124050050054048124.html APUS.RU | Мышь белоногаÑ? узкоÑ?топаÑ? ...: ...hirtipes - обитает в Ð?вÑ?тралии; Sminthopsis longicaudata - обитает в Ð?вÑ?тралии; Sminthopsis macroura обитает в ... http://www.deh.gov.au/biodiversity/threatened/action/marsupials/5.html Action Plan for Australian Marsupials and Monotremes - Taxon ...: Sminthopsis longicaudata Spencer, 1909, Long-tailed Dunnart, LR(lc), <10. Sminthopsis macroura (Gould, 1845), Stripe-faced Dunnart, LR(lc), <10. ... http://bighost.area.ba.cnr.it/srs6bin/wgetz?%5Btaxonomy-ParentId:9300%5D+-e TAXONOMY:9301 ID : 9301 PARENT ID : 9300 RANK : species GC ID : 1 ...: ...fat-tailed dunnart // TAXONOMY:9302 ID : 9302 PARENT ID : 9300 RANK : species GC ID : 1 MGC ID : 2 SCIENTIFIC NAME : Sminthopsis macroura PREFERRED COMMON NAME ... http://artedi.ebc.uu.se/cfg2000/aln/PDA1.aln CLUSTAL W (1.8) multiple sequence alignment Alcaligenes eutrophus ...: GKMLAAVS-----RVLSGVAQKPAS-----RVLVA--- Sminthopsis macroura, ODPA ----- Rattus ... http://artedi.ebc.uu.se/cfg2000/ml/txt/PDA1.txt QUARTET PUZZLING TREE Support for the internal branches of the ...: 98: :-83: : : : :Sus scrofa, ODPA : : : :-97: : :-92: : : : :Sminthopsis macroura, ODPA : : : : :Rattus norvegicus ... http://savanna.ntu.edu.au/education/students/alex_kutt.html Tropical Savannas CRC - Spatial patterns of distribution ...: Downs mouse Leggadina lakedownensis, Desert Mouse Pseudomys desertor and Pebble-mound mouse Pseudomys patius, Common Dunnart Sminthopsis macroura and the Julia ... http://www.rmit.edu.au/departments/ps/staffpgs/francisextra/abstract.htm abstracts: Francis AJP, Coleman GJ (1990) Ambient temperature cycles entrain the free-running circadian rhythms of the Stripe-faced Dunnart, Sminthopsis macroura. ... http://authors.elsevier.com/JournalDetail.html?PubID=275&index=S&Precis=KIND Elsevier Author Gateway: Sminthopsis A developmental investigation of the liver, bone marrow and spleen of the stripe-faced dunnart (Sminthopsis macroura) JM Old, L. Selwood and EM ... http://www.birdlist.org/biodiversity/mammals/allmammals/mammallist1.htm Mammallist1: Dunnart, Spencer, 1909. DASYUROMORPHIA, Dasyuridae, Sminthopsis, macroura, Darling Downs Dunnart, (Gould, 1845). DASYUROMORPHIA, Dasyuridae, ... http://www.adelaide.edu.au/health/anat/staff/julie.html Anatomical Sciences: Haynes, JI and Skidmore, GW (1991). Haematology of the dasyurid marsupials Sminthopsis crassicaudata and Sminthopsis macroura. Aust J Zool 39: 157-69. ... http://filin.km.ru/mammels/sumchpredator.htm хищные Ñ?умчатые: мелкими позвоночными. УЗКОЛÐ?ПÐ?Я СУМЧÐ?ТÐ?Я МЫШЬ (Sminthopsis macroura), Ð?ИÐ?ГÐ?УИ (Ningaui ... http://www.csiro.au/communication/rabbits/rab1212.htm Rabbit News - Press Releases (1996): ...spinifex hopping mouse (Notomys alexis), lesser hairy-footed dunnart (Sminthopsis youngsoni ) and the stripe-faced dunnart (Sminthopsis macroura) had either re ... http://physiolgenomics.physiology.org/cgi/content/abstract/17/2/130 Physiol. Genomics -- Abstracts: Jastroch et al. 17 (2): 130: ...and identified uncoupling protein 2 (UCP2) and UCP3 full-length cDNAs in libraries constructed from the marsupials Antechinus flavipes and Sminthopsis macroura ... http://www.windrug.com/pic/30/11/28/109.htm 大众医è?¯ç½‘- 文献资料 ...: ...è‡é¼©ï¼ˆSuncus）ã€?å°?型有袋类动物一袋鼬（Dasyuroides）å?Šé•¿å°¾è¢‹ 鼩（Sminthopsis Macroura）ç‰ï¼Œå¹¶æ£åœ¨è¿›è¡Œç ”究它们的实验动物化 ... http://www.speciesaccounts.org/Mammals.htm Mammals: Sminthopsis granulipes (narrow-footed marsupial ‘mouse’). Sminthopsis macroura (narrow-footed marsupial ‘mouse’). Sminthopsis ... http://eo.wikipedia.org/wiki/Senplacentuloj Senplacentuloj - Vikipedio: Sminthopsis leucopus specio : poÅ?soriko longvosta - Sminthopsis longicaudata specio : poÅ?soriko striovizaÄ?a - Sminthopsis macroura specio : poÅ?soriko ... http://www.fwcp.org/manage/planname.htm Plan Scientific & Common Names: Rabbit; Ovis aries - Sheep; Sminthopsis crassicaudata - Fat-tailed Dunnart; Sminthopsis macroura - Stripe-faced Dunnart; Sminthopsis ... http://www.fwcp.org/manage/backnathist.htm Background Information Natural History: The Fat-tailed (Sminthopsis crassicaudata), Stripe-faced (Sminthopsis macroura) and Common Dunnart (Sminthopsis murina) occur either within or just outside the ... http://www.vet.cam.ac.uk/research/cytogenetics/cells.html Cambridge Veterinary School: MCL: List of species: ...tridactylus) 12, 13; Fat-tailed dunnart (Sminthopsis crassicaudata) 14; Stripe-faced dunnart (Sminthopsis macroura) 14; Short-tailed opossum ... http://www.mult-sclerosis.org/news/Dec2001/TrialsOfEarlyPregnancyFactorToBegin.html Publications: Early Pregnancy Factor concentrations during pregnancy and embryonic development in Sminthopsis macroura (Spencer) (Marsupialia: Dasyuridae) Reproduction, 2001 ... http://cbis.anu.edu.au/publications.html ANU - CBiS Publications: J., Chang, LE, Wakefield, MJ,Graves, JAM, and Deeb, SS The Cone Visual Pigments of the Australian Marsupials, the Stripe-Faced (Sminthopsis macroura) and Fat ... http://www.bioone.org/bioone/?request=get-citation-links&doi=10.1043/0004-959X(1997)045%3C0157:GADOPY%3E2.0.CO;2&id=I0022-2372-083-01-0081-FRIGO1&sitename=BIOONE Citation Links: CITATION Frigo, L., Woolley, PA Growth and development of pouch young of the stripe-faced dunnart, Sminthopsis macroura (Marsupialia: Dasyuridae), in captivity ... http://www.bioone.org/bioone/?request=get-citation-links&doi=10.1043/0031-935X(1997)070%3C0331:DTAEEI%3E2.0.CO;2&id=I0022-2372-083-01-0081-SONG1&sitename=BIOONE Citation Links: CITATION Song, X., Geiser, F. Daily torpor and energy expenditure in Sminthopsis macroura : interactions between food and water availability and temperature ... http://biology.uky.edu/520/old/Labs/lab9/dunnartSRY.tfa.htm gi|382657|prf||1819484A SRY-related protein [Sminthopsis macroura] ...: ...>gi|382657|prf||1819484A SRY-related protein [Sminthopsis macroura] MCSFLDVEVKDRFVEGDFGMSEMVKSNLANCSSRVKRPMNAFMVWSQTQRRKVALQNPKMHNSEISKQLG ... http://www.pac.ne.jp/AOSCE/program.htm AOSCE2004Nara: 12:30-13:00: S-09. Torpor patterns in the marsupial Sminthopsis macroura: Photoperiod and hormonal correlates. N. Feay, BM McAllan and F. Geiser. ... http://sciences.une.edu.au/esnrm/page.asp?PgName=staff_details&StID=2726 UNE Sciences -Staff Details: Xiaowei Song (1997) Thermal and metabolic strategies of two marsupials, Sminthopsis macroura and Cercartetus nanus: a physiological comparison between daily ... http://www.vesmir.cz/clanek.php3?CID=2149 VesmÃr - Podivuhodnà savci Austrálie: NejhojnÄ›jÅ¡Ãm druhem, s nÃmž jsem se pravidelnÄ› ve stÅ™ednà Austrálii setkával, byla vakomyÅ¡ bÄ›lopásá (Sminthopsis macroura), která má svÄ›tlé ... http://dels.nas.edu/ilar/jour_online/39_2_3/39_2_3ChromPaintMarsupials.asp ILAR Journal Online, Volume 39(2/3) 1998: Comparative Gene Mapping: For instance, Sminthopsis macroura (family Dasyuridae) shows very little deviation from the proposed ancestral marsupial 2n=14 karyotype. ... http://www.museum.vic.gov.au/bioinformatics/mammals/images/Pod_macr.htm Museum Victoria [ed-online] Bioinformatics - Victorian Mammal ...: Australian Mammal Gould Print Images John Gould print image of the Stripe-faced Dunnart Sminthopsis macroura (formerly known as Podabrus macrourus). ... http://www.chickest.udel.edu/orthochick/c403.html BLAST Search Results: ...mRNA for transthyretin 213 3e-54 emb|X80998.1|SMMRTRTH S.macroura mRNA for transthyretin 211 9e-54 gb|U12518.1|SMU12518 Sminthopsis macroura transthyretin mRN ... http://www.imtech.res.in/pub/mmbm/hmg/dos/HMG.raw sp|Q02486|ABF2_YEAST ARS-BINDING FACTOR 2 PRECURSOR.|ABF2.1 ...: ...pir|S29081|S29081 SRY protein homolog - Sminthopsis macroura|marsTDF PKTPQQLWYTHEKKVYLKVRPDATTKEVKDSLGKQWSQLSDKKTLKWIHKALEQRKEYEEIMRDYI >gp|S46279|S46279_1 SRY ... http://arjournals.annualreviews.org/doi/abs/10.1146/annurev.physiol.66.032102.115105 Annual Review of Physiology - 66(1):239 - Full Text: TMR. View larger version (23K), Figure 2 Metabolic rates measured as oxygen consumption of a dunnart (Sminthopsis macroura). Similar ... http://www.sanger.ac.uk/Info/Statistics/ The Sanger Institute : Sanger Institute Information: Pan troglodytes (Chimpanzee), 0, 201,637, 201,637. Sminthopsis macroura (Marsupial Mouse), 49,131, 549,208, 598,339. Sus scrofa (Pig), 218,565, 1,787,568, 2,006,133. ... http://www.staff.vu.edu.au/PsychDept/Kennedy.html Dr Gerard Kennedy: GA, Coleman, GJ, & Armstrong, SM (1996) Daily restricted feeding effects the circadian activity rhythms of the stripe-faced dunnart (Sminthopsis macroura). ... http://mpc.uci.edu/hampson/public_html/blast/jf_no_rrna/nrResults/taa25c02.y1.html BLAST Search Results: 82 3e-15 *ref|NP_062556.2| hypothetical protein 669 [Homo sapiens] >g... 80 6e-15 *gb|AAD00328.1| RBM1 [Sminthopsis macroura] 80 7e-15 *emb|CAA63557.1| RNA ... http://www.ddbj.nig.ac.jp/ddbjnew/org1000/org5.html TOP 1000 ORGANISMS (501-600): 6 Human immunodeficiency virus 2 929393 1588 Tropheryma whipplei TW08/27 926038 3 uncultured delta proteobacterium 920503 1264 Sminthopsis macroura 911586 65 ... http://www.nrm.se/ncc/mammalia.txt D1940302-ULC @MAMMALIA "SYSTEMATIC NUMBER","VALIDATION MARKER" ...: SMIN LOND1","Sminthopsis longicaudata","",NCC940302" "898035654503","1","E"," ",SMIN MACD1","Sminthopsis macroura","",NCC940302" "898035654503","7 ... http://www.cazr.csiro.au/pub_1985_81.htm CSIRO CAZR - Publications List 1981-85: ...pp.257-262. Morton, SR (1984). Sminthopsis crassicaudata, Sminthopsis macroura, Leggadina forresti. In ‘The Complete Book of Australian Mammals’. ... http://sege.ntu.edu.sg/cgi-bin/extract_info.pl?dbase=gbmam&field=protein&pop=39&type=1 Your Search Results: Your Search Results. click here for format explanation Phase Colours={0}{1}{2}. > 54038_AF064208 Sminthopsis macroura interleukin-5 (IL5) gene, partial cds ... http://www.latrobe.edu.au/rgso/dvcr/info/97rrep/pubs/s&t/lifesci97.html Zoology: 1997. Frigo, L. & Woolley, P. A. Development of the skeleton of the stripe-faced Dunnart, Sminthopsis macroura (Marsupialia: Dasyuridae). ... http://parasite.vetmed.ufl.edu/vivax-suspect/html/gss/Pv/209/209PvE11.html National Center for Biotechnology Information (NCBI) welcome to ...: 38 0.053 gi|4098582 (U79567) RBM1 [Sminthopsis macroura] 35 0.60 ref|NP_014518.1|HRP1| putative polyadenylated-RNA-binding p... 34 0.78 gi|4097898 (U71267 ... http://www.mujweb.cz/Veda/traxler/senplac.htm superordo : SENPLACENTULOJ - Metatheria (Aplacentalia) - vaÄ?natci: ...specio : poÅ?soriko striovizaÄ?a - Sminthopsis macroura. specio : poÅ?soriko ordinara - Sminthopsis murina. specio : poÅ?soriko oldea - Sminthopsis ooldea. ... http://www.worldwildlife.org/wildworld/profiles/terrestrial/aa/aa0707_full.html Terrestrial Ecoregions -- Mitchell grass downs (AA0707): Small carnivorous marsupials, typically including the long-tailed planigale (Planigale ingrami) and the stripe-faced dunnart (Sminthopsis macroura), are among ... http://trace.ensembl.org/perl/traceview?attr=ce_sp_tt&ce_27=1 [an error occurred while processing this directive] Sminthopsis macroura [an error occurred while processing this directive] 40546 Stripe-Faced Dunnart Stripe-Faced Dunnart Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |