|
|
Stochomys longicaudatus - Target RatIUCN Status: Lower Risk/Least ConcernIUCN Species Profile http://www.press.jhu.edu/books/walkers_mammals_of_the_world/rodentia/images/image.rodentia.muridae.stochomys.html Thumbnails Page, Rodentia Muridae Stochomys: Rodentia Muridae Stochomys (Click on thumbnail to view larger image). Target rat (Stochomys longicaudatus), photo by DCD Happold. ... http://www.press.jhu.edu/books/walkers_mammals_of_the_world/rodentia/images/image.mid.rodentia.muridae.stochomys.longicaudatus.1.html Image Page, Rodentia Muridae Stochomys: Rodentia Muridae Stochomys. Target rat (Stochomys longicaudatus), photo by DCD Happold. Return to Genus Copyright © 1997 by the Johns Hopkins University Press. http://www.itis.usda.gov/servlet/SingleRpt/SingleRpt?search_topic=TSN&search_value=585081 ITIS Standard Report Page: Stochomys: Genus, Stochomys Thomas, 1926, Direct Children: Species, Stochomys longicaudatus (Tullberg, 1893), References, Expert(s): Expert: Guy G. Musser, ... http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Retrieve&dopt=Citation&list_uids=97176443 Substitution rate variation in closely related rodent species.: ...have sequenced the adenine phosphorybosyltransferase (APRT) gene from Mus spicilegus, Mus pahari, Mastomys hildebrandtii, Stochomys longicaudatus and Gerbillus ... http://pedant.gsf.de/cgi-bin/wwwfly.pl?Set=Mycoplasma_genitalium_G37&Alias=Mycoplasma_genitalium_G37&Page=taxrankspecies Mycoplasma_genitalium_G37: ...carnosus staphylococcus epidermidis staphylococcus sp staphylococcus warneri staphylococcus xylosus stochomys longicaudatus streptococcus agalactiae ... http://pedant.gsf.de/cgi-bin/wwwfly.pl?Set=Treponema_pallidum_Nichols&Alias=Treponema_pallidum_Nichols&Page=taxrankspecies Treponema_pallidum_Nichols: ...carnosus staphylococcus epidermidis staphylococcus warneri staphylococcus xylosus stigmatella aurantiaca stochomys longicaudatus streptococcus agalactiae ... http://www.micro-genomes.mpg.de/cgi-bin/getblast.cgi?pir030305.orfprot.RB5847-apt.blastp getblast.pl beck@molgen-mpg.de: 146 2e-34 SWISSPROT:APT_GERCA Q64414 gerbillus campestris (gerbil). adenin... 145 2e-34 SWISSPROT:APT_STOLO P47958 stochomys longicaudatus. adenine phos... ... http://www.micro-genomes.mpg.de/cgi-bin/getblast.cgi?pir030305.orfprot.RB328-pyrE.blastp getblast.pl beck@molgen-mpg.de: 33 2.6 SWISSPROT:APT_STOLO P47958 stochomys longicaudatus. adenine phos... 33 2.7 SWISSPROT:APT_STRPN Q97pm8 streptococcus pneumoniae, and strepto... ... http://sege.ntu.edu.sg/cgi-bin/extract_info.pl?dbase=gbrod&field=protein&pop=179&type=1 Your Search Results: G}GEPNGGGWEWSNNDIMNYVNWERNPSTALDRGFCG SLSRSS{G}FLRWRDTTCEVKLPYVCKFTG > 43602_SLU28723 Stochomys longicaudatus adenine phosphoribosyltransferase (APRT)gene ... http://www.earthscape.org/r2/scb/scb14_6/maj01/maj01a.html Variation in Pesticide Tolerance of Tadpoles among and within ...: HAET, Hylomyscus aeta; HALL, Hylomyscus alleni; LNUD, Lophuromys nudicaudus; PTUL, Praomys tullbergi; PSTR, Protoxerus strangeri; SLON, Stochomys longicaudatus. ... http://www.fmnh.helsinki.fi/users/haaramo/Metazoa/Deuterostoma/Chordata/Synapsida/Eutheria/Rodentia/Myomorpha/Murinae.htm Muridae: Murinae: ...| |-- A. silindensis (silindanpensasrotta(!!"selindan")) | | A. stannarius ()? | ` A. thomasi ()? |- Stochomys longicaudatus ()? |-o Dephomys ()? ... http://www.cs.ubc.ca/~jslack/tj/mammalia_A_03-04-16.nh (((((('platypus')'ornithorhynchus')'ornithorhynchidae' ...: ...ceramicus','stenomys niobe','stenomys richardsoni','stenomys vandeuseni','stenomys verecundus')'stenomys',('stochomys longicaudatus')'stochomys',('sundamys ... http://genome.uiowa.edu/projects/placenta/summaries/diff-gene-expression/mouse-mouse/analysis/annot/UI-1-BY0-ahr-e-10-0-UI.s1.seq.blastn.nt.html Blast Results: ...protein (Pem) gen... 139 1e-30 gb|AF189319.1|SLONPEM2|AF189319.1|SLONPEM2 Stochomys longicaudatus homeobox protein ... 127 4e-27 ... http://www.chickest.udel.edu/orthomouse/m257.html BLAST Search Results: 103 2e-20 gb|L29546.1|SYSSDPA Stochomys longicaudatus sex-determing p... 103 2e-20 gb|AF277096.1|AF277096 Danio rerio HMG box transcription fa... ... http://www.chickest.udel.edu/orthohuman/h295.html BLAST Search Results: 53 6e-05 gb|L29546.1|SYSSDPA Stochomys longicaudatus sex-determing p... 53 6e-05 gb|AY058313.1| Drosophila melanogaster GH07353 full length ... ... http://bighost.area.ba.cnr.it/srs6bin/wgetz?%5Bswissprot-AccNumber:P47958%5D+-e General Information about the Entry: Description, adenine phosphoribosyltransferase (EC 2.4.2.7) (aprt). Gene name(s), aprt. Organism source, Stochomys longicaudatus (Target rat). ... http://srs.embl-heidelberg.de:8000/srs5bin/cgi-bin/wgetz?-e+%5B%7Bswissprot_SP_swissnew%7D-acc:P47958%5D ID APT_STOLO STANDARD; PRT; 180 AA. AC P47958; DT 01-FEB-1996 (Rel ...: 41, Last annotation update) DE Adenine phosphoribosyltransferase (EC 2.4.2.7) (APRT). GN APRT. OS Stochomys longicaudatus (Target rat). ... http://www.blackwell-synergy.com/links/doi/10.1046/j.1439-0469.2002.00172.x/abs/ The phylogeny of the Praomys complex (Rodentia: Muridae) and its ...: The species Malacomys longipes and Stochomys longicaudatus were chosen as outgroups, based on previous studies where they unambiguously appeared out of the ... http://www.blackwell-synergy.com/links/doi/10.1046/j.1523-1739.2000.99070.x/full/ Influence of Timber Extraction Routes on Central African Small ...: ...n = 116; Hylomyscus aeta, n = 113; Hylomyscus alleni, n = 387; Lophuromys nudicaudus, n = 5; Praomys tullbergi, n = 379; and Stochomys longicaudatus, n = 19). ... http://www.savci.upol.cz/hlod-3.htm Rodentia - Hlodavci: 1904) - krysa - Slender Rat. Stochomys longicaudatus (Tullberg, 1893) - krysa terÄ?ová - Target Rat. Sundamys infraluteus (Thomas ... http://perso.club-internet.fr/boudetjo/ZooList/Mammif/ClasRode.html Classification des Rodentiens: Stenomys ceramicus Stenomys niobe Stenomys omlichodes Stenomys richardsoni Stenomys vandeuseni Stenomys verecundus Stochomys longicaudatus Sundamys infraluteus ... http://helix.biology.mcmaster.ca/721/outline2/node17.html Are there homologues in the database?: 1002 1.3e-290 10 gb|M11310|MUSAPRT Mouse adenine phosphoribosyltransfe... 1002 2.6e-290 10 gb|U28723|SLU28723 Stochomys longicaudatus adenine pho... ... http://genome.jgi-psf.org/cgi-bin/dispGeneModel.v4?db=chlre2&tid=157788 Protein Pages: Chlamydomonas reinhardtii (Chlamy): ...genome.jgi-psf.org/cgi-bin/ dispGeneModel.v4?db=chlre2&tid=157788 - 23k - Cached - Similar pages Protein Pages: Phanerochaete chrysosporium (White Rot fungus)genome.jgi-psf.org/cgi-bin/ dispGeneModel.v4?db=whiterot1&id=72907 - 27k - Cached - Similar pages Mammifères des parcs nationaux du Congo - ... Paraxerus boehmi Paraxerus alexandri Pelomys fallax concolor Praomys jacksoni Protoxerus strangeri Rattus rattus Stochomys longicaudatus Tachyoryctes splendens ... http://genome.jgi-psf.org/cgi-bin/dispGeneModel.v4?db=whiterot1&id=72907 Protein Pages: Phanerochaete chrysosporium (White Rot fungus): ...genome.jgi-psf.org/cgi-bin/ dispGeneModel.v4?db=whiterot1&id=72907 - 27k - Cached - Similar pages Mammifères des parcs nationaux du Congo - ... Paraxerus boehmi Paraxerus alexandri Pelomys fallax concolor Praomys jacksoni Protoxerus strangeri Rattus rattus Stochomys longicaudatus Tachyoryctes splendens ... http://bch-cbd.naturalsciences.be/congodr/cdr-fra/contribution/strataction/etat/annexes/tab7.htm Mammifères des parcs nationaux du Congo: ...- ... Paraxerus boehmi Paraxerus alexandri Pelomys fallax concolor Praomys jacksoni Protoxerus strangeri Rattus rattus Stochomys longicaudatus Tachyoryctes splendens ... http://www.phthiraptera.org/Mammals/Muridae.html Mammals: Muridae: Stenomys verecundus (Thomas, 1904) - Slender Rat Stochomys. Stochomys longicaudatus (Tullberg, 1893) - Target Rat Sundamys - Giant Sunda Rats. ... http://genoma.unsam.edu.ar/projects/tca/blast_dir/nr/tca-02e23.b1.br BLASTX 2.1.3 [Apr-1-2001] Reference: Altschul, Stephen F., Thomas ...: ...sp|P47958|APT_STOLO ADENINE PHOSPHORIBOSYLTRANSFERASE (APRT) gb|AAA68959.1| (U28723) adenine phosphoribosyltransferase [Stochomys longicaudatus] Length = 180 ... http://nar.oupjournals.org/cgi/content/full/27/22/4457 Nucl. Acids. Res. -- Bourdeau et al. 27 (22): 4457: MPU28721; position 1128-1163), Stochomys longicaudatus (accession no. SLU28723; position 1060-1113), Rattus norvegicus (accession no. ... http://industry.ebi.ac.uk/~alan/BioWidget/Taxonomy/tax4.data 1 root 1 2759 Eukaryotae 1 42452 unclassified eukaryotes 2759 ...: ...hadrourus 36798 36800 Uromys caudimaculatus 36798 36237 Mus musculus x Rattus norvegicus 39107 34855 Stochomys 39107 34856 Stochomys longicaudatus 34855 34857 ... http://spock.jouy.inra.fr/NCBI/apt.html BLASTP 2.0.11 [Jan-20-2000] Reference: 173 sp|P47958|APT_STOLO ADENINE PHOSPHORIBOSYLTRANSFERASE (APRT) >gi|881578 (U28723) adenine phosphoribosyltransferase [Stochomys longicaudatus] Length = 180 ... http://www.infobiogen.fr/db/cutg/CUTG/gbrod.spsum Abrothrix jelskii: 1 0 2 1 0 1 0 1 1 4 2 1 1 1 7 0 4 6 0 1 5 0 2 2 ...: 103 170 46 96 153 141 85 71 31 92 203 61 123 198 167 101 58 172 86 61 126 206 178 160 91 80 74 49 177 105 35 122 109 149 63 4 8 4 Stochomys longicaudatus: 2 2 ... http://www.esapubs.org/archive/ecol/E084/094/MOMv3.3.txt AF extant Artiodactyla Bovidae Addax nasomaculatus 4.85 70000.3 60 ...: ...- ... albocaudata 2.16 144 60 AF extant Rodentia Muridae Stenocephalemys griseicauda 1.93 85.7 60 AF extant Rodentia Muridae Stochomys longicaudatus 1.85 71 "130, 135 ... http://www.centrcn.umontreal.ca/~bourdeav/Ribonomics/RIBO/DB_RIBO/HTML/AMP_right1/AMP_right1.rod.sol.filN.REP.CS.html RNA Secondary Structures: SCO 100.90|POS:591-625|MIS: 2|WOB: 2| |UGGG|G|AGGG|CUGGAUG|UCCA|GGUAGAAGCUG|CUGA| --- SLU28723 Stochomys longicaudatus adenine phosphoribosyltransferase (APRT ... http://bioinfo.hku.hk/db/cutg/gbrod.spsum Acomys cahirinus: 2 1 12 8 4 1 4 2 7 11 3 1 6 3 12 2 3 13 2 5 16 2 ...: 53 96 151 29 85 142 118 75 65 30 88 187 55 114 182 143 86 50 147 75 54 119 191 159 147 84 75 69 47 169 95 32 118 103 123 54 4 8 3 Stochomys longicaudatus: 2 2 ... http://www.nouvellesapproches.org/PKB/faune/mamal_fr.htm [an error occurred while processing this directive] Stochomys longicaudatus [an error occurred while processing this directive] 20863 Target Rat Target Rat Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |