|
Tatera kempi - Kemp's GerbilIUCN Status: Lower Risk/Least ConcernIUCN Species Profile http://www.pasteur.fr/recherche/banques/CRORA/bibref/br00360.htm CRORA : VIRUS DE REFERENCE Saboya: ...- ... Isolé par le CRORA, Institut Pasteur de Dakar (Sénégal), à partir d'un prélèvement sanguin sur Tatera kempi (Rongeur), sous la référence An D 4600. ... http://www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=Tatera+kempi+gambiana+%5Bgbrod%5D Codon usage table: Tatera kempi gambiana [gbrod]: 1 CDS's (149 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU 6.7( 1) UCU 13.4( 2 ... http://www.kazusa.or.jp/codon/T.html Alphabetical list: T: ...gbvrt]: 3 Taricha granulosa [gbvrt]: 1 Taro bacilliform virus [gbvrl]: 3 Tarsius bancanus [gbpri]: 3 Tarsius syrichta [gbpri]: 10 Tatera kempi gambiana [gbrod ... http://www.gerbil-info.com/html/species.htm Species: ...southern Africa. Tatera gambiana = Tatera kempi (Kemp's gerbil). ... Syria to India, Sri Lanka. Tatera kempi = Tatera gambiana (Kemp's gerbil). ... http://www.psb.ugent.be/rRNA/ssu/data/MitTatX8.EAN acc:X84391 src: str: ta1:Eukaryota Metazoa Chordata Craniata ...: ...str: ta1:Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Rodentia Sciurognathi Muridae Gerbillinae Tatera {Tatera kempi} chg: rem ... http://www.interaktv.com/mammals/Rodentia2myo.html Biologybase: Mammals of the World: Rodentia 2 (Myomorpha): Tatera brantsii. Tatera guineae. Tatera inclusa. Tatera indica. Tatera kempi. Tatera leucogaster. Tatera nigricauda. Tatera phillipsi. Tatera robusta. Tatera valida. ... http://www.cdc.gov/ncidod/eid/vol7no4/scherret.htm CDC - The Relationships between West Nile and Kunjin Viruses: KOU DakAad 5443, 1968, Tatera kempi (rodent), Senegal, Africa, AF196532 (E gene). ... KOUDakAad 5443, 1968, Tatera kempi (rodent), Senegal, L48980, NS5/3UTR, 17. ... http://www.ifrance.com/nblanluet/infogen/origine.htm Origine de la gerbille: ...- ... savanne Tatera valida gerbille du Cap Tatera afra gerbille de Boehm Tatera boehmi gerbille de Brant Tatera brantsii gerbille de Kemp Tatera kempi gerbille de ... http://www.ig-rennmaeuse.de/andererennmausarten.htm rennmausarten im ueberblick: ...- ... Indische Nacktsohlenrennmaus, Indian Gerbil (Tatera indica). Kemp´s Gerbil (Tatera kempi). Phillip´s Gerbil (Tatera phillipsi). Savanna Gerbil (Tatera valida). ... http://www.vzz.nl/overvzz/wg-intern/benin2002.htm Werkbezoek Benin 2000 - VZZ: Zoölogisch Museum met 'dubbele' exemplaren eveneens een Beninse collectie wordt gevormd.) In een 'battue' werd een nest van Tatera kempi uitgegraven. Lokoli. ... http://129.69.143.22/training/bioinformatics02/solutions/GROUP5/session9/task1neuesPAttern ScanProsite: ...acyltransferase (EC 2.3.1.43) (Lecithin-cholesterol acyltransferase) (Phospholipid-cholesterol acyltransferase) (Fragment) [Tatera kempi gambiana (Kemp's gerbil ... http://gerbil.info/species.htm SPECIES AND SUB SPECIES OF GERBILLINAE: Tatera gambiana = Tatera kempi (Kemp's gerbil), from Gambia to upper Cameroun. ... Tatera kempi = Tatera gambiana (Kemp's gerbil), from Gambia to upper Cameroun. ... http://www.unep-wcmc.org/protected_areas/data/sample/0288p.htm IUCN Management Category: ...anubis, vervet monkey Cercopithecus aethiops, patas monkey Erythrocebus patas, Gambian sun squirrel Heliosciurus gambianus, gerbil Tatera kempi, spiny mouse ... http://www.uvm.edu/~jdecher/ProgRep.html Progress Report: Mus musculoides 3. Pygmy Mouse. 1. 1. Tatera kempi 3. Kemp's savanna gerbil. 1. Anomalurus beecrofti 4. Beecroft's scaly-tailed flying squirrel. 1. ... http://www.tg.refer.org/togo_ct/rec/jrs_ub/resumes1.htm Résumé en français du Journal de la Recherche Scientifique de l ...: ...- ... Plusieurs espèces de rongeurs, en particulier Arvicanthis niloticus, Mastomys natalensis (Muridés) et Tatera kempi (Cricetidés) sont régulièrement ... http://www.cse.ucsc.edu/research/compbio/yeast-protein-predictions/YNR0/YNR008W/YNR008W.t2k.pa.html a2m2html output for file tmp.a2m: ...cholesterol acyltransferase); gi|2177110|gb|AAB58989.1| lecithin-cholesterol acyl transferase [Tatera kempi gambiana]. gi|2177152|gb ... http://www.savci.upol.cz/hlod-2.htm Rodentia - Hlodavci: ...& Wroughton, 1908 - pískomil mozambický - Gorongoza Gerbil Tatera indica (Hardwicke, 1807) - pískomil indický - Indian Gerbil Tatera kempi Wroughton, 1906 ... http://perso.club-internet.fr/boudetjo/ZooList/Mammif/ClasRode.html Classification des Rodentiens: Rhombomys opimus Sekeetamys calurus Tatera afra Tatera boehmi Tatera brantsii Tatera guineae Tatera inclusa Tatera indica Tatera kempi Tatera leucogaster ... http://www.bioone.org/bioone/?request=get-document&issn=0022-2585&volume=038&issue=04&page=0480 Arbovirus Surveillance from 1990 to 1995 in the Barkedji Area ...: Koutango (KOU, Flaviviridae, genus Flavivirus) was first isolated from Tatera kempi trapped in 1968 near Saboya village in Senegal (Robin 1972 ). ... http://sege.ntu.edu.sg/cgi-bin/extract_info.pl?dbase=gbrod&field=protein&pop=292&type=1 Your Search Results: ...- ... S}DLTKDITTSVLTVNNKAHMVTLDYTVQVPGAGRDG APGF{S}KFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG > 43605_TKLCAT02 Tatera kempi gambiana lecithin ... http://bioinformatics.weizmann.ac.il/databases/embl/align/ds35643.dat Title: Mammalian mitochondrial 12S rRNA sequences AUTHOR: Marc W. ...: ...(unpub.) Rodentia Muridae Rattus norvegicus X14848; Gadaleta et al. (1989) Rodentia Muridae Tatera kempi gambiana X84391; Hanni et al. ... http://www.cs.uccs.edu/~tsbach/sq.dat sp|P00678|RNPA_CAVPO Ribonuclease pancreatic A (EC 3.1.27.5) ...: YDASV >sp|Q9WUX4|RNP_TATKG Ribonuclease pancreatic precursor (EC 3.1.27.5) (RNase 1) (RNase A) - Tatera kempi gambiana (Kemp's gerbil). ... http://www.cs.uccs.edu/~tsbach/results.html Search Results: Q9WUX4 Description sp|Q9WUX4|RNP_TATKG Ribonuclease pancreatic precursor (EC 3.1.27.5) (RNase 1) (RNase A) - Tatera kempi gambiana (Kemp's gerbil). ... http://www.infobiogen.fr/db/embl-align/ds38659.dat TITLE: Alignment of 12S rRNA sequences from 118 mammalian taxa ...: MAV Muscardinus avellanarius X84384 NRU Nesomys rufus X99462 PLU Peromyscus leucopus X99463 RNO Rattus norvegicus X14848 TGA Tatera kempi gambiana X84391 HHY ... http://www.infobiogen.fr/db/cutg/CUTG/gbrod.spsum Abrothrix jelskii: 1 0 2 1 0 1 0 1 1 4 2 1 1 1 7 0 4 6 0 1 5 0 2 2 ...: 6 8 21 11 10 23 12 6 8 11 9 13 12 30 8 16 16 14 19 7 1 22 26 3 28 48 21 13 7 35 13 7 24 30 36 20 23 12 12 7 20 14 5 26 14 27 20 3 0 0 Tatera kempi gambiana: 1 ... http://riviste.neteditor.it/tz/articoli.php?idelemento2=569 NetEditor - Sezione Tz: ...and NOR banding). The cranial morphology confirms the attribution of this sample to Tatera kempi Wroughton 1906. An analysis of ... http://srs.pku.edu.cn/srs7bin/cgi-bin/wgetz?-id+4xStq1MdeiS+-e+%5BSPD:'RNP_TATKG'%5D Entry Page: 40, Last annotation update) DE Ribonuclease pancreatic precursor (EC 3.1.27.5) (RNase 1) (RNase A). GN RNASE1. OS Tatera kempi gambiana (Kemp's gerbil). ... http://walnut.bioc.columbia.edu/srs7bin/cgi-bin/wgetz?-id+4xSuH1M08Rl+-e+%5Bswall:RNP_TATKG%5D Entry Page: Description, ribonuclease pancreatic precursor (EC 3.1.27.5) (rnase 1) (rnase a). Gene name(s), rnase1. Organism source, Tatera kempi gambiana (Kemp's gerbil). ... http://www.icb.ufmg.br/~lgb/schisto/blastNR/Contig398.htm BLAST Search Results: ...acyltransferase) (Phospholipid-cholesterol acyltransferase) gb|AAB58989.1| (U72298) lecithin-cholesterol acyl transferase [Tatera kempi gambiana] Length = 293 ... http://www.esapubs.org/archive/ecol/E084/094/MOMv3.3.txt AF extant Artiodactyla Bovidae Addax nasomaculatus 4.85 70000.3 60 ...: ...- ... Muridae Tachyoryctes splendens 2.33 212.3 "63, 70" AF extant Rodentia Muridae Tatera boehmi -999 -999 -999 AF extant Rodentia Muridae Tatera kempi 2 101 -999 ... http://industry.ebi.ac.uk/~alan/BioWidget/Taxonomy/tax4.data 1 root 1 2759 Eukaryotae 1 42452 unclassified eukaryotes 2759 ...: 49439 Gerbillurus 10045 49440 Gerbillurus vallianus 49439 48138 Psammomys 10045 48139 Psammomys obesus 48138 41262 Tatera 10045 41263 Tatera kempi 41262 41264 ... http://www.phthiraptera.org/Mammals/Muridae.html Mammals: Muridae: Polyplax stephensi (Christophers and Newstead, 1906) *. Tatera kempi Wroughton, 1906 - Kemp´s Gerbil Polyplax parataterae Kim and Emerson, 1972 *. ... http://bioinfo.hku.hk/db/cutg/gbrod.spsum [an error occurred while processing this directive] Tatera kempi [an error occurred while processing this directive] 21515 Kemp's Gerbil Kemp's Gerbil Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |