|
Tragelaphus oryx - Common Eland, ElandIUCN Status: Lower Risk/Conservation DependentIUCN Species Profile http://www.forestryimages.org/browse/detail.cfm?imgnum=4321056 common eland, Bovidae: Tragelaphus oryx N/A - Forestry Images: ...common eland, Bovidae: Tragelaphus oryx N/A Image Number: 4321056. Subject: common eland. ... http://www.funet.fi/pub/sci/bio/life/mammalia/artiodactyla/bovidae/tragelaphus/ Tragelaphus: See [About maps]. Tragelaphus oryx (Pallas, 1766) Eland oryx (Pallas, 1766); Misc. Zool.: 9, TL: Cape of Good Hope Taurotragus oryx ; ... http://www.funet.fi/pub/sci/bio/life/warp/album-Schmode-1.html Images from Ralf Schmode: Ralf Schmode, Tragelaphus spekei [spekei-2.jpg] 705x600(~111Kb) Hannover Zoo, Germany, June 2001 (juvenile), Photo © Ralf Schmode, Tragelaphus oryx [oryx-1m.jpg ... http://1kai.dokkyomed.ac.jp/mammal/en/species_all/tragelaphus_oryx.html Tragelaphus oryx: Tragelaphus oryx Eland Classification. Order: Artiodactyla (Even-toed Ungulates) Family: Bovidae (Cattle, Antelope, Sheep, Goats) Genus: Tragelaphus (Bushbucks) ... http://1kai.dokkyomed.ac.jp/mammal/jp/species_all/tragelaphus_oryx.html Tragelaphus oryx: Tragelaphus oryx Eland イランド(エランド) 分類. 目:Artiodactyla(Even-toed Ungulates, å?¶è¹„目) 科:Bovidae ... http://www.vulkaner.no/n/africa/antilope.html VÃ¥r vidunderlige verden: Antiloper: Tragelaphus imberbis Lesser Kudu Liten kudu. Tragelaphus strepsiceros Greater Kudu Stor kudu. Tragelaphus oryx derbianus T. oryx gigas Eland Kjempe-elgantilope. ... http://www.animals-online.be/hoofed_mammals/holhoornigen/eland.html Eland (Tragelaphus oryx): Fact Sheet: Scientific name. Tragelaphus oryx. English name. Eland. Nederlandse naam. Elandantilope Kaapse eland. Nom Français. Eland du Cap. Deutsche name. Elenantilope. Homepage. ... http://www.infochembio.ethz.ch/links/zool_saeuget_antilope.html Antilopen: Säugetiere: Eland (Taurotragus oryx) - Text and Image. Elands - Text and Image. Elenantilope (Tragelaphus oryx) - Text und Abbildung. Ellipsen-Wasserbock - Abbildungen. ... http://www.masai-mara.com/mmscx.htm Order: Bongo. Tragelaphus imberbis. Lesser Kudu. Tragelaphus oryx (Taurotragus oryx). Common Eland. Tragelaphus scriptus. Bushbuck. Tragelaphus spekei. Sitatunga. ... http://www.nhm.org/research/mammals/holdings/ARTIODAC.HTM Mammal Collection Holdings - Order ARTIODACTYLA: ...eurycerus Kenya 1 Tragelaphus eurycerus 4 Tragelaphus imberbis Kenya 5 Tragelaphus imberbis Uganda 2 Tragelaphus imberbis 2 Tragelaphus oryx Kenya 2 ... http://www.chez.com/monamiph/afsud94.htm Liste naturaliste afrique du sud 1994: ...- ... Tragelaphus angasi Gray Nyala Krüger, Mkuzi, Hluhluwe; Tragelaphus oryx Pallas Eland Giant castle, Pietersburg, Willem pretorius; ... http://www.chez.com/monamiph/zambie.htm Liste naturaliste Zimbabwe Zambie 2001: ...- ... Bovides: Raphicerines: Tragelaphus oryx Pallas Eland vu un bel individu derrière la cloture d'une ferme avant la ville de Hwange; ... http://nl.wikipedia.org/wiki/Rund Rund - Wikipedia NL: Tragelaphus eurycerus, Bongo; Tragelaphus oryx, Elandantilope; Tragelaphus derbianus. Subfamily Cephalophinae: duikers, 19 species ... http://www.jordals.dk/fugle/halali.htm Halali Camp: Halali Camp, Etosha. 041003. spotted hyena, Crocuta crocuta. eland, Tragelaphus oryx. Meyer's parrot, Poicephalus meyeri. tawny eagle, Aquila rapax. ... http://www.jordals.dk/fugle/waterber.htm Waterberg National Park: ...common eland, Tragelaphus oryx, in group with roan. southern pale chanting goshawk with very black tail. swallow tailed bee eater, Merops hirundineus. ... http://www.fact-index.com/b/bo/bovinae.html Bovinae: Common Eland, Tragelaphus oryx; Giant Eland, Tragelaphus derbianus. Subfamily Cephalophinae: duikers, 19 species in 2 genera; Subfamily ... http://www.mhr-viandes.com/fr/docu/docu/d0002344.htm BÅ“uf, ou bovin: ...- ... Boselaphus : Boselaphus tragocamelus (nilgai) Eland (Tragelaphus oryx)- Bubalus : Bubalus bubalis (water buffalo) / Bubalus depressicornis (lowland anoa ... http://www.americazoo.com/goto/index/mammals/380.htm Eland: Eland - TRAGELAPHUS ORYX. Class: Animals with Milk Glands (Mammalia) Subclass: True Mammals (Eutheria) Order: Even-toed Mammals (Artiodactyla) Family: Bovidae. ... http://www.szgdocent.org/ung/a-ung4c.htm SPIRAL HORNED BOVINES or TRAGELPHINES: The Tragelphines include the Bongo (Tragelaphus euryceros), Nyala (Tragelaphus angasi), Greater Kudu (Tragelaphus strepsiceros), Eland (Tragelaphus oryx). ... http://www.szgdocent.org/ung/a-eland.htm Singapore Zoological Gardens - Docent: COMMON ELAND (Tragelaphus oryx ... http://www.lastrefuge.co.uk/photolibrary/image_index/species_index2.html Species List (Common Names AZ): Adrian Warren Photo library: Caecilian (Legless Amphibian), Caecilia sp. Camel, Camelus dromedarius. Cape Eland, Tragelaphus oryx. ... http://www.lastrefuge.co.uk/photolibrary/image_index/mammals_index1.html Species List (Common Names AZ): Adrian Warren Photo library: Dormouse, Muscardinus avellanarius, England. Dormouse, Edible Dormouse, Glis glis, England. Eland, Tragelaphus oryx, Akagera Nat. Park, Rwanda. ... http://www.omne-vivum.com/c/12165.htm genus Taurotragus- -: ...- Taurotragus,Taurotragus oryx, Eland-antilope, Kaapse antilope, Eland, Tragelaphus oryx, Taurotragus derbianus, Derbi-antilope, Grote eland, Reuzeneland, http://utne.nvg.org/g/bovidae.html SkrivarstuÃ¥: Fe (Bovidæ): ...lesser kudu); Tragelaphus oryx (eland); Tragelaphus scriptus (EN: bushbuck); Tragelaphus spekii (sitatunga); Tragelaphus strepsiceros ... http://www.invasive.org/browse/subimages.cfm?sub=3585 common eland: Tragelaphus oryx (Artiodactyla: Bovidae): ...common eland. ... http://www.vmnh.net/education/ed&exmounts.htm Public Programs Taxidermy Database: 35, Blue wildebeest, 1698, Connochaetes, taurinus, HM, U, head mount,VMNH Temp 070, N. 36, Eland, 1699, Tragelaphus, oryx, HM, M, head mount,VMNH Temp 049, N. ... http://www.zoo.org.au/animal_page.cfm?area_id=49&zoo_id=3&animal_id=114 Eland: Eland Tragelaphus oryx. Back to Victoria's Open Range Zoo home. I'ma Eland and I'ma postcard too! Not only are Eland the largest type ... http://www.zoo.org.au/postcard_form.cfm?Animal_ID=114&area_id=49&zoo_id=3 Send the Eland as a postcard!: Send the Eland as a postcard! Tragelaphus oryx. Back to Victoria's Open Range Zoo home. Your friend's firstname. Your firstname Your ... http://www.bwfoto.dk/da/lister.asp?side=pattedyr Bert Wiklund Fotograf: RÃ¥dyr (Capreolus capreolus) Giraf (Giraffa campelopardalis) Giraf (Giraffa reticulata) SKEDEHORNEDE (Bovidae) Elsdyrantilope (Tragelaphus oryx) Lille Kudu ... http://www.dennisminty.com/stock_list/Mammals.html Stock List | Animals | Mammals: Impala, Aepyceros melampus (Africa - Kenya, Tanzania, Malawi, Botswana); Eland, Tragelaphus oryx (Africa - Kenya, Malawi, Tanzania); ... http://www.mafunyane.com/animals.htm Wecome to Mafunyane: Black Wildebeest, Connochaetes gnou. Eland, Tragelaphus oryx. Springbuck, Antidorcas marsupialis. Reedbuck Mountain, Redunca fulvorufula. ... http://www.highbeam.com/library/search.asp?FN=AO&refid=ency_refd&search_thesaurus=on&refid=ency_refd&q=eland HighBeam Research: eLibrary Search: Results: GIANT Eland (Taurotragus derbianus = Tragelaphus derbianus) is considered by some to be a subspecies of the Common or Southern Eland (Tragelaphus oryx), but is ... http://elib.cs.berkeley.edu/photos/fauna/sci-Mammal.html CalPhotos: Browse Mammal Scientific Names: 1) Thomomys townsendii (1) Thylogale billardierii (2) Thylogale thetis (1) Tolypeutes matacus (2) Tragelaphus imberbis (1) Tragelaphus oryx (1) Tragelaphus ... http://www.tutorgig.com/encyclopedia/getdefn.jsp?keywords=Bovinae Bovinae | TutorGig.com Encyclopedia: Bongo , Tragelaphus eurycerus; Common Eland , Tragelaphus oryx; Giant Eland , Tragelaphus derbianus. Subfamily Cephalophinae : duikers ... http://www.tutorgig.com/encyclopedia/getdefn.jsp?keywords=bovinae bovinae | TutorGig.com Encyclopedia: ...buxtoni Lesser Kudu , Tragelaphus imberbis Greater Kudu , Tragelaphus strepsiceros Bongo , Tragelaphus eurycerus Common Eland , Tragelaphus oryx Giant Eland ... http://www.deli-ostrich.com/prod_map_antelope.htm Welcome to Deli Ostrich: Impala (Aepyceros melampus) (<<) Black Wildebeest or Gnu (Connochaetes gnou) (<<) Gemsbok, Gemsbuck or Oryx (Oryx gazella) - Eland (Tragelaphus oryx) (<<). ... http://www.matlabas.co.za/mammals.txt LIST OF MAMMALS: Scientific name English Afrikaans Galago ...: ...larvatus Bushpig Bosvark Giraffa camelopardalis Southern giraffe Kameelperd Syncerus caffer caffer Cape buffalo Buffel Tragelaphus oryx Cape eland Kaapse eland ... http://www.spies.com/~sullivan/stories/Africa2000/mammals.html Mammals from Uganda and Kenya safari: Bushbuck, Tragelaphus scriptus. Lesser Kudu, Tragelaphus imberbis. Eland, Tragelaphus oryx. Blue Duiker, Cephalophus monticola. Bush Duiker, Sylvicapra grimmia. ... http://www.orthopedia-shop.de/glossar/glossar_wort-ELENANTILOPE/elenantilope.html Glossar ELENANTILOPE: ...- medizinisches Lexikon Thema : ...imberbis Großer Kudu Tragelaphus strepsiceros Bongo Tragelaphus eurycerus Elenantilope Tragelaphus oryx Riesen Elenantilope ... http://www.orthopedia-shop.de/glossar/glossar_wort-IANUS/ianus.html Glossar IANUS: ...- eurycerus Elenantilope Tragelaphus oryx Riesen Elenantilope Tragelaphus derbianus Tribus Boselaphini Vierhornantilope Tetracerus quadricornis Nilgauantilope ... http://www.acapixus.dk/galleri/slides/59.htm AcaPixus - Index over analoge billeder: Masai giraf (Giraffa camelopardalis tippelskirchi) Serengeti NP / Tanzania KOL5927 / 36x24 / Eland, elsdyrantilope (Tragelaphus oryx, Bovidae) Ngorongoro NP ... http://www.prodex.de/lexikon/r/ri/rinder.html Prodex - Der Produktexperte: ...- ... Tragelaphus eurycerus; Elenantilope, Tragelaphus oryx; Riesen-Elenantilope, Tragelaphus derbianus. Tribus Boselaphini: Vierhornantilope ... http://robetta.bakerlab.org/taxonomy.jsp?id=909 Robetta Server Job 909 NR PSI-Blast Taxonomy Results: Hippotragus equinus]. 9945, Tragelaphus oryx, 1 (0.75%), 6E-35, 10-99, 1-90, 146, 90, 90, gb|AAK67743.1|, kappa-casein [Tragelaphus oryx]. 9986, ... http://robetta.bakerlab.org/taxonomy.jsp?id=910 Robetta Server Job 910 NR PSI-Blast Taxonomy Results: Oreotragus oreotragus]. 9945, Tragelaphus oryx, 1 (0.72%), 2E-38, 10-99, 1-90, 159, 90, 90, gb|AAK67743.1|, kappa-casein [Tragelaphus oryx]. 119560, ... http://members.aol.com/PbowenD2/Africa.mammals.htm Mammals I saw in Africa: Greater Kudu, Tragelaphus strepsiceros. Eland, Tragelaphus oryx. African Buffalo, Synceros caffer. Bush (Common) Duiker, Sylvicapra grimmia. ... http://www.aoba.sakura.ne.jp/~momoncyo/zoo/animal_eland.htm Eland:イランド: ...イランド(エランド), ■希少種. 英å?? Eland å¦å?? Tragelaphus oryx, 分布域 æ?±ãƒ»å?—・ä¸å¤®ã‚¢ãƒ•リカ. [ã?¨ã?¹å‹•物園 photo by Umi]. ... http://erinandkevin.homestead.com/files/pictures/AfricaAnimals/africaAnimals.htm Africa Animals: ...buffalo.jpg (2653 bytes) African Bufffalo Syncerus Caffer, Wildebeest Wildebeest Connochaetes taurinus, Eland <br><i>Tragelaphus oryx</i> Eland Tragelaphus oryx, ... http://www.blackwell-synergy.com/links/doi/10.1046/j.1365-3008.2001.00157.x/abs/ Briefly - Oryx, Vol 35, Issue 1, pp. 3-13 (Full Text): Declines of over 70 per cent were recorded in buffalo Syncerus caffer, giraffe Giraffa camelopardalis, eland Tragelaphus oryx and waterbuck Kobus ellipsiprymnus ... http://www.blackwell-synergy.com/links/doi/10.1046/j.1365-2028.2002.00306.x/abs/ Vegetation gradients around artificial water points in the Central ...: ...large herbivores found in the reserve are blue wildebeest (C. taurinus), greater kudu (Tragelaphus strepsiceros), eland (Tragelaphus oryx), red hartebeest ... http://www.leszoosdanslemonde.com/html/europe/zoo_allemagne/karlsruhe/karlsruhe_zoo/karlsruhe_zoo.htm Zoologischer Garten Karlsruhe: ...- ... Le second est habité par des autruches (Struthio camelus australis), des zèbres de Boehm (Equus quagga boehmi) et des élands du Cap (Tragelaphus oryx). ... http://www.sagarmatha.com/galleries/Tanzania/Tanzania.html 1999 Africa Trip: Tanzania: Sun and clouds. The last animals were zebras, wildebeest, eland (Tragelaphus oryx), Thompson's gazelles, giraffe, and grants gazelles. ... http://www.lotek.com/gps1000.htm Lotek Fish & Wildlife Monitoring Systems - GPS_1000 Monitoring ...: Full features and benefits list. Eland (Tragelaphus oryx) equipped with a GPS_1000 collar. Central Kalahari Game Reserve, Kalahari Desert, Botswana, Africa. ... http://www.fao.org/livestock/lspa/glipha/cowdro.htm Data Sheet for cowdriosis: Syncerus caffer, Wild host, Cattle & Buffaloes: All Stages, Tragelaphus oryx, Wild host, Tragelaphus spekii, Wild host, [ return to top ]. Animals Affected. ... http://www.web-dictionary.org/encyclopedia/bo/Bovine.html Bovinae - Wikipedia: Bongo, Tragelaphus eurycerus; Common Eland[?], Tragelaphus oryx; Giant Eland[?], Tragelaphus derbianus. Subfamily Cephalophinae: duikers ... http://www.uwsp.edu/geo/faculty/heywood/geog358/exotics/exoticML.htm COMMON NAME: ...mammal hoofed; alpaca, Lama guanaco pacos, Peru, Chile, Bolivia, Australia, mammal hoofed; antelope eland, Tragelaphus oryx, 1964, Africa, Texas, Australia (died out), ... http://www.tiere-online.de/to_lex_10.asp?Text=antilope Tiere Online - Das Lexikon: ...- ... Deutsche Bezeichnung: Elenantilope. Lateinische Bezeichnung: Tragelaphus oryx. Klasse: Säugetier. Ordnung: Paarhufer. Familie: Antilopen. ... http://www.produkteseite.de/lexikon/artikel-Rinder.html border="1" cellspacing="0" style="float:right;margin-left:0.5em" ! ...: ...- ... Großer Kudu]], ''Tragelaphus strepsiceros'' ** [Bongo]], ''Tragelaphus eurycerus'' ** [Elenantilope]], ''Tragelaphus oryx'' ** [Riesen-Elenantilope ... http://www.meandmephoto.com/Africa/Pages/Antelope/Eland5.html Eland: ..."A Little Suspicious". The Eland (Tragelaphus oryx) is the largest antelope. Both sexes have spiral horns, but the female's are shorter and thinner. ... http://www.safari-tanzanie.com/gallery/eland/ eland, caommaon eland safari Tanzanie Tanzania photo pictures: ...safari Tanzanie 2004 Éland du Cap, Tragelaphus oryx oryx, Common Eland accueil. http://www.eskimo.com/~rowdenw/EEA/photo/spp/spp-Even_Toe.html Even-Toed Ungulates: Impala. (Aepyceros melampus). Spiral-Horned Antelopes. (Tribe Tragelaphini). Common Eland. (Tragelaphus oryx). Wild Cattle. (Tribe Bovini). African Buffalo. ... http://sege.ntu.edu.sg/cgi-bin/extract_info.pl?dbase=gbmam&field=protein&pop=69&type=1 Your Search Results: VEDLLQKHALVEADIGIQAERVRGVNASAQKFATDGE{G}YKPCDPQVIRDRVAHMEFCYQELCQLAAERRAR > 54325_AF210198 Tragelaphus oryx beta spectrin (SPTBN1) gene, partial cds.!Nuclear ... http://sege.ntu.edu.sg/cgi-bin/extract_info.pl?dbase=gbmam&field=protein&pop=49&type=1 Your Search Results: TINTTICAGYCMTR{D}VNGKLFLPKYALSQDVCTYRDFMYKTAEIPGCPRH > 54347_AF210220 Tragelaphus oryx thyroptin beta chain gene, partial cds.!Nuclear !Orgn:Tragelaphus oryx ... http://www.tapirback.com/tapirgal/bib-sub5.htm The Tapir Gallery - Tapir Bibliography, Subject Listing, Section 5: ...der geburt: einige Bemerkungen zur vermehrungsrate und generationsfolge dieserartem im Frankfurter Zoo [The behavior of the gerenuk, tragelaphus oryx and South ... http://www.themensuche.de/Rinder.html Rinder: ...- ... imberbis''; Großer_Kudu, ''Tragelaphus strepsiceros''; Bongo, ''Tragelaphus eurycerus''; Elenantilope, ''Tragelaphus oryx''; Riesen ... http://www.herberstein.co.at/de/tierpark/tierdetail.php?p_erdteil=AFRIKA&p_tier=TIER_232 Tiere - Afrika: ...- Afrika. Elenantilope Common Eland / Eland / Tragelaphus oryx Ordnung: Paarhufer. Familie: Hornträger. Verbreitung: Afrika. Lebensraum ... http://www.karlsruhe.de/Zoo/eantilop.htm Stadt-Zoo Karlsruhe - Die Elanantilope: ...- Elenantilope. Tragelaphus oryx Eland antelope / Eland. Verbreitung: Südliches Afrika, Ostafrika. Lebensraum: Offene Buschsavanne bis zur Halbwüste. ... http://www.tiergarten.nuernberg.de/tierinfo_antilope.html Tiergarten Nürnberg: ...- Elenantilope Tragelaphus oryx, Eland. Eland. Antilopa losÃ. Ordnung, Paarhufer. Familie: Hornträger. Größe: Männchen bis 180 cm, Weibchen ... http://www.peacelink.de/keyword/Bovinae.php Bovinae - Wikipedia, the free encyclopedia: Bongo, Tragelaphus eurycerus; Common Eland, Tragelaphus oryx; Giant Eland, Tragelaphus derbianus. Subfamily Cephalophinae: duikers, 19 ... http://www.ergo-light.com/ERGO/CGI/prot.cgi?prot=RBME00792&user= Protein Page for RBME00792 from Brucella melitensis 16M (IG-21): ...dehydrogenase [imported], Neurospora crassa, tr|O97897, 7.43e-76, 1737, 555, 15, Xanthine:oxygen oxidoreductase, Tragelaphus oryx, tr|Q9MYW6, 4.73e ... http://www.ergo-light.com/ERGO/CGI/prot.cgi?prot=RBME00791&user= Protein Page for RBME00791 from Brucella melitensis 16M (IG-21): ...tr|O97897, 2.41e-15, 581, 794, Xanthine:oxygen oxidoreductase, Tragelaphus oryx, sp|P22985, 7.14e-15, 581, 794, Xanthine dehydrogenase/oxidase, Rattus norvegicus, ... http://www.annalsnyas.org/cgi/content/full/990/1/573 ANNALS ONLINE -- ZWEYGARTH and JOSEMANS 990 (1): 573: ...from three species of wild African ruminants (sable antelope [Hippotragus niger], buffalo [Syncerus caffer], eland antelope [Tragelaphus oryx]) and from a bush ... http://genome.jgi-psf.org/cgi-bin/getAlign.pl?db=ciona4&table=protein&name=137522&hitName=nr_4336762&host=genome QUERY: 137522 (348) Hit: nr_4336762 (1332) defLine: gi|4336762|gb ...: QUERY: 137522 (348) Hit: nr_4336762 (1332) defLine: gi|4336762|gb|AAD17938.1| xanthine:oxygen oxidoreductase [Tragelaphus oryx] SCORE: 786 EVALUE: 0 Alignment ... http://www.gisbau.uniroma1.it/amd/amd222.html ARTIODACTYLA: Ph.D. Thesis: Nairobi University. Hillman JC (1987). Group size and association patterns of the common eland (Tragelaphus oryx). J. Zool., Lond.: 213, 641-664. ... http://www.ime.fraunhofer.de/oeko/abt/oekochem/tierartennachweis_content.htm Tierartenbestimmung: ...- ... Säugetiere. Tierart. Lateinische Bezeichnung. (Elen)-Antilope. Tragelaphus oryx. Bison. Bison bison. Elch. Alces Alces. Esel. Equus asinus asinus. Hase. Lepus europaeus. ... http://alnilam.mi.mss.co.jp/rgadb/chro10/OSJNAa0087H07_07.html OSJNAa0087H07_07: 1| xanthine dehydrogenase [Mus musculus] (Score = 562, Expect = e-158) gi|4336762|gb|AAD17938.1| xanthine:oxygen oxidoreductase [Tragelaphus oryx] (Score = 558 ... http://alnilam.mi.mss.co.jp/rgadb/chro03/OSJNBa0087O09_19.html OSJNBa0087O09_19: 1| xanthine dehydrogenase [Gallus gallus] (Score = 591, Expect = e-167) gi|4336762|gb|AAD17938.1| xanthine:oxygen oxidoreductase [Tragelaphus oryx] (Score = 573 ... http://www.up.ac.za/academic/healthsciences/medicine/urology/staffBarnhoorn.htm Dr Irene Barnhoorn: ...in various projects concerning the effects of endocrine disrupting chemicals (EDC) on reproductive physiology of the common eland (Tragelaphus oryx) and the ... http://www.up.ac.za/academic/healthsciences/medicine/urology/research/uroPaper01.htm Environmental Endocrine Disruptors: ...chemical (EDC) exposure. Testicular calcifications in the common eland (Tragelaphus oryx): A possible link to endocrine disruption. ... http://www.elephantcare.org/hematolo.htm hematolo: Serum samples from 97 domestic pigs (Sus scrofa) slaughtered in Harare, Zimbabwe, in 1995, and from 19 elands (Taurotragus oryx [Tragelaphus oryx]), 67 sable ... http://www.cza.nic.in/view_animal.asp?txtSearchText=E Click the Animal Name to View: Egret Large, Ardea alba. Egret Little, Egretta garretta. Eland, Tragelaphus oryx. Elephant African, Loxodonta africana. Elephant Indian, Elephas maximus. ... http://www.rubricon.com/afr_ann/..%5Cann%5Cafr%5C12_k%5C12_k32093.asp канна / Рубрикон / ÐнциклопедичеÑ?кий ...: канна. канна, Ñ?ланд (Tragelaphus oryx), парнокопытное животное группы антилоп. Ðндемик Ð?фрики. ... http://informatics.icipe.org/nzi/Publications/Abstracts/Davies94.htm Davies94: ...caught female G. pallidipes maintained for 41 days on fresh defibrinated blood of rabbit, buffalo (Syncerus caffer), eland (Tragelaphus oryx), waterbuck (Kobus ... http://www.infobiogen.fr/db/embl-align/ds42701.dat ACCESSION NUMBER: ds42701 TITLE: Molecular insights into the ...: ...caffer African buffalo CONSTRUCTED Boselaphus tragocamelus Nilga CONSTRUCTED Tragelaphus imberbis Lesser kudu CONSTRUCTED Tragelaphus oryx Common eland ... http://www.infobiogen.fr/db/embl-align/ALIGN_000090.dat ID ALIGN_000090; RNA; 942 symbols (29 sequences) XX AC ...: ...quadricornis SO 18 TangasiAF0 AF091698 Tragelaphus angasii SO 19 TimberbAF0 AF091697 Tragelaphus imberbis SO 20 ToryxAF091 AF091710 Tragelaphus oryx SO 21 ... http://www.evcforum.net/ubb/Forum5/HTML/000125.html Well - EvC Forum: Bos Taurus Equus grevyi Bos indicus 4,56% Bos javanicus 9,30% Bison bison 8,33% Bubalus bubalis 12,81% Boselaphus tragocamelus 12,63% Tragelaphus oryx 13,33 ... http://www.limpopo-safaris.com/showpage.php?page=vildtarter_dk Limpopo-safaris.com: Underarter: SCI lister Eland som Tragelaphus oryx med tilhørende tre underarter, hvilket vil sige at SCI medregner eland til de spiralhornede antiloper. ... http://de.wikipedia.org/wiki/Rinder Rinder - Wikipedia: ...- ... eurycerus; Elenantilope, Tragelaphus oryx; Riesen-Elenantilope, Tragelaphus derbianus. Tribus Boselaphini: Vierhornantilope, Tetracerus ... http://www.actx.edu/~porter_da/vftn/tour/African/eland.htm Common Eland: Return to the African Gallery. Common Eland (Tragelaphus oryx) The common eland is not only the biggest but also the slowest antelope ... http://www.nih.go.jp/yoken/genebank/MNCb/seq5/MNCb-0886.BLA BLASTN 2.0a2MP-WashU [20-Oct-1996] [Build 22:58:53 Oct 20 1996] ...: 1090 1.3e-43 1 OM|U20753||| FCU20753 Felis catus mitochondrion, comple... 1119 1.7e-43 1 OM|AF030275||| AF030275 Tragelaphus oryx cytochrome oxida... ... http://www.cutler-davies-photography.co.uk/cgi-bin/gallery.pl?cat=3&subsection=21&httpd= [an error occurred while processing this directive] Tragelaphus oryx [an error occurred while processing this directive] 22055 Common Eland, Eland Common Eland, Eland Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |