Tupaia belangeri - Northern Tree Shrew

IUCN Status: Lower Risk/Least Concern
IUCN Species Profile
ITIS Standard Report Page: Tupaia belangeri: Go to Print Version, Tupaia belangeri (Wagner, 1841) Taxonomic Serial No.: 573217. ... Genus, Tupaia Raffles, 1821, Species, Tupaia belangeri (Wagner, 1841), References, ...
http://www.itis.usda.gov/servlet/SingleRpt/RefRpt?search_type=expert&search_id=expert_id&search_id_value=55

ITIS 'Expert(s)' Search results for Don E. Wilson: Tupaia Raffles, 1821 -- valid. Tupaia belangeri (Wagner, 1841) -- valid. Tupaia chrysogaster Miller, 1903 -- valid. Tupaia dorsalis Schlegel, 1857 -- valid. ...
http://www.pubmedcentral.nih.gov/articlerender.fcgi?artid=150834&rendertype=abstract

Primary hepatocytes of Tupaia belangeri as a potential model for ...: 2002 January 15; 109 (2): 221 232 DOI: 10.1172/JCI0213011 Primary hepatocytes of Tupaia belangeri as a potential model for hepatitis C virus infection. ...
http://www.pubmedcentral.nih.gov/articlerender.fcgi?tool=pubmed&pubmedid=10618396

Molecular cytogenetic dissection of human chromosomes 3 and 21 ...: Painting probes we used here were derived from the tree shrew or tupaia (Tupaia belangeri) (11) and the African green monkey (Cercopithecus aethiops) homologs ...
http://genoma.unsam.edu.ar/projects/tupaia/tupaia-c.html

genoma.unsam.edu.ar :: tupaia :: Tupaia belangeri hippocampal ...: ...genoma.unsam.edu.ar :: tupaia :: Tupaia belangeri hippocampal subtracted ESTs. ...
http://genoma.unsam.edu.ar/projects/tupaia/

genoma.unsam.edu.ar :: Tupaia belangeri ESTs: Gene expression in the tree shrew (Tupaia belangeri) hippocampus. Web appendix. If you happen to find any errors, typos, broken links ...
http://www.blackwell-synergy.com/links/doi/10.1111/j.0021-8782.2004.00282.x/enhancedabs/

Antigenic compartmentation of the primate and tree shrew ...: Antigenic compartmentation of the primate and tree shrew cerebellum: a common topography of zebrin II in Macaca mulatta and Tupaia belangeri. ...
http://merops.sanger.ac.uk/speccards/peptidase/sp002130.htm

Peptidase of Tupaia belangeri (northern tree shrew): Tupaia belangeri (northern tree shrew). TAXONOMY. Taxonomy database identifier: 37347. Superkingdom, Eukaryota. Kingdom, Animalia. Subkingdom, Metazoa. Phylum, Chordata. ...
http://www.unifr.ch/anatomy/rk.html

Robert Kretz @ Unit of Anatomy, University of Fribourg: ...system; Topographic organization of the optic nerve, tract, dorsal lateral geniculate nucleus, and the primary visual cortex in the tree shrew (Tupaia belangeri ...
http://www.unifr.ch/pns/members/kretz

Program in Neuroscience: Kretz: ...the developing and mature visual system. Our chosen animal model is the tree shrew, Tupaia belangeri. This creature is the closest ...
http://www.lifesci.ucsb.edu/eemb/faculty/collins/publications.html

Peter Collins | Selected Publications: Collins, PM, Tsang, WN and Lofts, B. (1982). Reproductive function in the captive male tree-shrew (Tupaia belangeri). Biology of Reproduction 26, 169-182. ...
http://www.dpz.gwdg.de/clineu/teaching/tupaia/start.htm

tupaia belangeri tree shrew: ...- Since December 1983 the German Primate Center is breeding and housing and breeding tree shrews (Tupaia belangeri).
http://www.dpz.gwdg.de/clineu/people/fuchs/start.htm

Eberhard Fuchs Learning and memory in tupaia belangeri tree shrews: ...- Learning and memory of tree shrews can be tested on a 'hole board' that contains 23 holes covered by a movable lid (see the little blocks in the picture). ...
http://www.das-tierlexikon.de/spitzhoernchenartige.htm

Spitzhörnchenartige: ...- ... Der Schwanz ist genauso lang wie die Kopf-Rumpf-Länge. Es erreicht ein Gewicht von etwa 160 g. Das Belanger-Tupaja (Tupaia belangeri) lebt in Indochina. ...
http://www.das-tierlexikon.de/inhalt_sp.htm

Spitzhörnchenartige: ...- ... Südliches Bergtupaja. - Tana. - Tieflandtupaja. - Tupaia. - Tupaia belangeri. - Tupaia glis. - Tupaia gracilis. - Tupaia javanica. - Tupaia longicauda. ...
http://www.uni-goettingen.de/jahresforschungsberichte/9798/medizin/anatomie.html

Jahresforschungsbericht @ Georg-August-Universität Göttingen: ...- ... Modelle erforderlich sind. Unter diesem Gesichtspunkt dokumentiert die Abteilung die Ontogenese von Tupaia belangeri. Sie stützt ...
http://www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=Tupaia+belangeri+%5Bgbmam%5D

Codon usage table: Tupaia belangeri [gbmam]: 15 CDS's (5705 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU 18.4( 105) UCU 14.4( 82 ...
http://www.hceis.com/product/index/mammals/biology%20of%20chnese%20tree%20shrews.htm

Science Books: Biology of Chinese Tree Shrews (Tupaia Belangeri Chinensis) 树鼩生物学 In Chinese and English summary ...
http://www.hceis.com/product/index/Mammals.htm

Science Books: Biology of Chinese Tree Shrews (Tupaia Belangeri Chinensis) Peng Yanzhang ,1991; A Dictionary of Mammalian Names (Latin Chinese English) Wang Song ,2001; ...
http://pubs.nrc-cnrc.gc.ca/cgi-bin/rp/rp2_abst_e?cjpp_y04-022_82_ns_nf_cjpp4-04

NRC Research Press: Canadian Journal of Physiology and ...: ...- ... Toxic effect of chloromycetin on the ultrastructures of the motor neurons of the Chinese tree shrew (Tupaia belangeri) Farong Yu, Fahong Yu, Rende Li, and Rui ...
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&list_uids=10958850&dopt=Abstract

The complete mitochondrial genome of Tupaia belangeri and the ...: Click here to read The complete mitochondrial genome of Tupaia belangeri and the phylogenetic affiliation of scandentia to other eutherian orders. ...
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&list_uids=9851694&dopt=Abstract

Corticotropin-releasing factor receptor type 1 from Tupaia ...: Click here to read Corticotropin-releasing factor receptor type 1 from Tupaia belangeri--cloning, functional expression and tissue distribution. ...
http://cellbank.nihs.go.jp/celldata/jcrb0745.htm

JCRB0745:T-23 clone 8: Other name: T-238. Animal: tupaia. Sex and Age: M :young. Scientific Name: Tupaia belangeri. Tissue: lung. Case history: normal. Genetics: normal. Life span: finite. ...
http://bieson.ub.uni-bielefeld.de/volltexte/2004/438/

BieSOn - Lichtmikroskopische und ultrastrukturelle morphologische ...: ...- ... Lichtmikroskopische und ultrastrukturelle morphologische Veränderungen in der Hippocampusformation von Tupaia (Tupaia belangeri) als Folge von chronisch ...
http://www.kiz.ac.cn/datasource/datasource-E/cellbank.htm

Database of the Kunming Cell Bank of Type Culture Collection: YBM Cloued leopard (Neofelis nebulosa) b KCB 85003 Common kestrel Common kestrel (Falco tinnunculus) b KCB 85004 TBT Tree shrew (Tupaia belangeri tonquinia) b ...
http://home.t-online.de/home/othmar.bahner/Primats/02.htm

Die Ordnung der Primaten: Halbaffen: ...- ... Tupaia Gewöhnliches Spitzhörnchen, Tupaia glis (Diard, 1820) Tupaia belangeri (Wagner, 1841) Tupaia montana Thomas, 1893 Tupaia nicobaria (Zelebor, 1869 ...
http://www.facultyof1000.com/pubmed/14986099

Rhombomere-specific patterns of apoptosis in the tree shrew Tupaia ...: Click here to read Rhombomere-specific patterns of apoptosis in the tree shrew Tupaia belangeri. Knabe W, Washausen S, Brunnett G, Kuhn HJ. ...
http://www.apus.ru/site.xp/056051048124050055055054124.html

APUS.RU | ТупайÑ? белангерова: ТупайÑ? белангерова - Tupaia belangeri - живет поодиночке или парами в дождевых леÑ?ах Юго ...
http://www.apus.ru/site.xp/049053057124-%F2.html

APUS.RU | Словарь Филина: ...squatarola; ТупайÑ? белангерова - Tupaia belangeri; ТупайÑ? большеногаÑ? - Tupaia longipes; ТупайÑ? ...
http://www.rosenblatt-dessous.de/Heiko-Meyer-Klonierung-und-Untersuchu-670-821-756-6.html

Klonierung und Untersuchung der zentralnervösen Genexpression a2 ...: ...- ... der zentralnervösen Genexpression a2 adrenerger Rezeptoren und ihre Regulation durch chronischen psychosozialen Streß bei Tupaia belangeri Heiko Meyer. ...
http://www.tiho-hannover.de/einricht/zoo/ezim/publ.htm

publ: 11. Hertenstein, B.; Zimmermann, E.; Rahmann, H. (1988): The development of visual acuity in tree shrews (Tupaia belangeri). Z. Säugetierkunde 53: 294-300. ...
http://www.noldus.com/applications/neuroscience/vankampen.html

User report: Psychoscocial stress in male tree shrews: an animal ...: ...types of stressors. The psychosocial stress model in male tree shrews (Tupaia belangeri) represents a promising paradigm. In their ...
http://members.tripod.com/cacajao/tree_shrews.html

Tree-shrews as Primates: Subfamily Ptilocercinae. Ptilocercus lowii, Pen-tailed tree-shrew. Subfamily Tupaiinae. Tupaia belangeri, Belanger's tree-shrew. Tupaia glis, Common tree-shrew. ...
http://members.tripod.com/nipah/May1999/19990520treeshrews.html

Tree shrew theory: Only recently we have isolated and characterized a novel paramyxovirus from an apparently healthy tree shrew (Tupaia belangeri) that had been captured in 1978 ...
http://www.kupsy.kyoto-u.ac.jp/banban/abstract/abst198-2.htm

Abstract No.198-2(2002/4/4): No.198-2(2002/4/4). How tree shrews (Tupaia belangeri) perform in a searching task: Evidence for strategy use. (ツパイ�探索課題���行方法 ...
http://www.cbs.dtu.dk/services/GenomeAtlas/show-atcontent.php?segmentid=Tbelangeri_Strain_mtDNA

DNA Structural Analysis of Sequenced Microbial Genomes: AT content in Tupaia belangeri strain Strain. ... Genome Atlas AT content (for Tupaia belangeri) has been accessed 20 times since 2004-03-26 00:34:07. ...
http://www.cbs.dtu.dk/services/GenomeAtlas/show-codon.php?segmentid=Tbelangeri_Strain_mtDNA

DNA Structural Analysis of Sequenced Microbial Genomes: Codon Usage in Tupaia belangeri strain Strain. ... Genome Atlas AT content (for Tupaia belangeri) has been accessed 21 times since 2004-03-26 00:34:07. ...
http://notes.utk.edu/bio/greenberg.nsf/0/d76afae359d0876a852564350081a5f2?OpenDocument

E&S MODEL: Tupaia, the tree shrew: THE TREE SHREW AS A MODEL ORGANISM FOR BEHAVIORAL ENDOCRINOLOGY OF SOCIAL AGGRESSION The tree shrew, Tupaia belangeri, is a diurnal squirrel size mammal that ...
http://www.viagen.com/about_pub_gregg.aspx

ViaGen, Inc. - About Us: ...(1987) Studies of ontogeny in tree shews (Tupaia Belangeri Chinensis). ... (1987) Reproduction in the tree shrew (Tupaia Belangeri Chinensis). ...
http://www.vet.ku.ac.th/vet-eng/anat/worawut/worawut-publication.htm

Publication and Research Activity of Dr.Worawut Rerkamnuaychoke: ...(1999): Immunohistochemical survey of the gut endocrine cells in the common tree shrew (Tupaia belangeri). J. Vet. Med. Sci. 61: 761-767. ...
http://perso.club-internet.fr/boudetjo/ZooList/Mammif/ClasScan.html

Classification des Tupaii: ...- ... TUPAIIIDAE, TUPAIINAE, Anathana Dendrogale Tupaia Urogale, Anathana ellioti Dendrogale melanura Dendrogale murina Tupaia belangeri Tupaia chrysogaster Tupaia ...
http://www.primate.wisc.edu/pin/idp/idp/entry/130

Institut fuer Zoologie (Primatological Section), Tieraerztliche ...: ...and Tupaia belangeri Principal Research Programs: Speaker of the DFG-funded interdisciplinary research programme on acoustic communication of emotions in ...
http://www.primate.wisc.edu/pin/idp/idp/entry/184

Institute of Zoology (Primatological Section), Divison Behavior ...: ...and Tupaia belangeri Principal Research Programs: Speaker of the DFG-funded interdisciplinary research programme: Acoustic communication of emotions in ...
http://savci.upol.cz/tany.htm

Scandentia - Tany: ...(syn. Tupaia ellioti) Tupaia belangeri (Wagner, 1841) - tana severní - Northern Tree Shrew Tupaia dorsalis Schlegel, 1857 - tana pruhovaná (syn. ...
http://hrzntweb-v1.hrz.uni-giessen.de/forschungsbericht/layout/einzel95.cfm?FB=11&Institut=2512&lfd_Nr=25p

Forschungsbericht: ...- ... Grün, Eva Knoop, Peter Kraß, Heike Lorenz, Mona Saniewski SCHLAGWÖRTER: Hepatitis B Virus; Viruspenetration ; Tupaia belangeri KURZBESCHREIBUNG: Das ...
http://www.mpih-frankfurt.mpg.de/global/Na/Pubs/DOC.HTM

Department of Neuroanatomy - Doctoral projects: ...- ... Darmstadt, 1998 Sandmann-Keil, D.: Postnatale Entwicklung von Neuronen in der Retina des Spitzhörnchens (Tupaia belangeri). Mainz ...
http://idw-online.de/public/zeige_pm.html?pmid=72089

idw - Verleihung des DPZ-Förderpreises: ...- ... Das Thema in Kürze: Nach chronischer psychosozialer Belastung findet im Hippocampus bei Spitzhörnchen (Tupaia belangeri) und Ratte (Rattus norvegicus) eine ...
http://www.chickest.udel.edu/orthochick/c59.html

BLAST Search Results: ...significant alignments: (bits) Value gb|L41563.1|CHKCRFR Gallus gallus corticotropin-releasing f... 803 0.0 emb|AJ422241.1|TBE422241 Tupaia belangeri mRNA for ...
http://robetta.bakerlab.org/results.jsp?id=725&p=17

Robetta Structure Prediction Server Job 725 Results - My beautiful ...: 37347, Tupaia belangeri, 1 (0.15%), 8E-62, 7-248, 104-359, 238, 32, 262, gi|12006364|gb|AAG44844.1|, matrix metalloproteinase-27 [Tupaia belangeri]. ...
http://robetta.bakerlab.org/taxonomy.jsp?id=921

Robetta Server Job 921 NR PSI-Blast Taxonomy Results: 37347, Tupaia belangeri, 2 (0.2%), 1E-126, 148-919, 6-776, 456, 30, 799, sp|Q95267|GCR_TUPGB, Glucocorticoid receptor (GR) emb|CAA99379.1| glucocorticoid receptor ...
http://medicine.ucsd.edu/cpa/tupaia.htm

Comparative Placentation: Embryol. 29:267-271, 2000. Kuhn, HJ and Schwaiger, A.: Implantation, early placentation and the chronology of embryogenesis in Tupaia belangeri. Anat. Embryol. ...
http://jvi.asm.org/cgi/content/abstract/75/11/5084

JVI -- Abstracts: Köck et al. 75 (11): 5084: The Asian tree shrew, Tupaia belangeri, has been proposed as a novel animal model for studying hepatitis B virus (HBV) infection. ...
http://jvi.asm.org/cgi/content/abstract/77/17/9511

JVI -- Abstracts: Glebe et al. 77 (17): 9511: The susceptibility of the tree shrew Tupaia belangeri to human hepatitis B virus (HBV) has been demonstrated both in vivo and in vitro. ...
http://opus.ub.uni-bayreuth.de/volltexte/2003/50/

OPUS - Bedeutung der Verpaarungsqualität für Verhalten und ...: ...- ... Uhl, Frank. Bedeutung der Verpaarungsqualität für Verhalten und Gesundheit von Spitzhörnchen (Tupaia belangeri). pdf-Format: Dokument 1.pdf (589 KB). ...
http://www.publish.csiro.au/nid/44/paper/RD01034.htm

CSIRO PUBLISHING - Reproduction, Fertility and Development: Ovulation in the tree shrew (Tupaia belangeri) induced by gonadotrophins Xiaomei Cao, Kunlong Ben and Xiaolei Wang Abstract. The ...
http://www.enzobio.com/thera_references.html

References: 1999. Oral tolerization therapy for HBV hepatitis in Tupaia belangeri. Third International Conference on Therapies for Viral Hepatitis, Maui, HI. Abstract. ...
http://members.aol.com/bafiler/Tupaiidae.html

Tupaiidae - Biognomen: ...javanica Tupaia minor Tupaia montana Tupaia nicobarica Tupaia palawanensis Tupaia picta Tupaia splendidula Tupaia tana Tupaia belangeri Tupaia chrysogaster ...
http://www.windrug.com/pic/30/11/28/115.htm

大众医�网- 文献资料- 第四节树鼩-<BR>-一 ...: ...树鼩的主����产地:. 1.Tupaia Belangeri Chinensis: 主�分布于我国云�的西部��部���等地。. ...
http://www.phthiraptera.org/Mammals/Tupaiidae.html

Mammals: Tupaiidae: Tree Shrew Tupaia - Tree Shrews. Tupaia belangeri (Wagner, 1841) - Northern Tree Shrew Sathrax durus Johnson, 1964. Tupaia chrysogaster ...
http://www.zeit.de/2003/06/Stressforschung

Die Zeit - Au weia, Tupaia: ...- ... Auf den ersten Blick sehen die Spitzhörnchen der Art Tupaia belangeri mit ihrem langen, buschigen Schweif aus wie graubraune Eichhörnchen. ...
http://wwwsoc.nii.ac.jp/jsvs/03_Journal/abstract-j/61-7j.html

Journal of Veterinary Medical Science: ...解 剖 学: コモンツパイ(Tupaia belangeri)�消化管内 分泌細胞��疫組織化学的検索. 山田純三・田内美由 紀 ...
http://getentry.ddbj.nig.ac.jp/cgi-bin/get_entry.pl?AY156931

Get Entry: Your query was: AY156931 LOCUS AY156931 1376 bp mRNA linear MAM 11-DEC-2002 DEFINITION Tupaia belangeri alpha-2A adrenoceptor mRNA, complete cds. ...
http://getentry.ddbj.nig.ac.jp/cgi-bin/get_entry.pl?AY150333

Get Entry: Your query was: AY150333 LOCUS AY150333 1356 bp mRNA linear MAM 25-NOV-2002 DEFINITION Tupaia belangeri alpha-2B adrenoceptor mRNA, complete cds. ...
http://pubmedcentral.com/articlerender.fcgi?artid=114913

Efficient Infection of Primary Tupaia Hepatocytes with Purified ...: Abstract. The Asian tree shrew, Tupaia belangeri, has been proposed as a novel animal model for studying hepatitis B virus (HBV) infection. ...
http://planete.simiesque.free.fr/prosimiens/classification/Tarsiiformes.php

Prosimiens - Tarsiiformes et Toupaiiformes: ...- ... Ptilocerque, Ptilocerque de Low, Ptilocercus lowii. Toupaye de Belanger, Tupaia belangeri. Toupaye de Mentaway, Tupaia chrysogaster. Toupaye rayé, Tupaia dorsalis. ...
http://www.innovations-report.de/html/berichte/preise_foerderungen/special-2960.html

Akademie-Preis für Biologie 2003 an Gießener Virologen: ...- ... des letzten Jahrhunderts gelang chinesischen Forschern die experimentelle Infektion des südostasiatischen Spitzhörnchens (Tupaia belangeri) mit Hepatitis B ...
http://www.basqueresearch.com/tesia_irakurri.asp?Gelaxka=1_1&Kodea=12&hizk=E

Basque Research: ...- ... Los tupaias (Tupaia belangeri) son unos pequeños mamíferos asiáticos filogenéticamente relacionados con los primates, que han demostrado ser parcialmente ...
http://mutage.oupjournals.org/cgi/content/abstract/1/5/359

Mutagenesis -- Abstracts: Taketomi et al. 1 (5): 359: Establishment of lung fibroblastic cell lines from a non-human primate Tupaia belangeri and their use in a forward gene mutation assay at the hypoxanthine ...
http://www.unav.es/animalario/estabulacion.htm

Servicio de Experimentación y Producción Animal: Animales: ...- ... Gallina. Perros. OTROS ANIMALES: Primates no-humanos (Macaca fascicularis), Tree shrew (Tupaia belangeri) Langosta (locusta migratoria). ...
http://www.circadian.org/data.html

Data Repository: The files contain body temperature data (in °C) for a 173 g male tree shrew (Tupaia belangeri) maintained at an environmental temperature of 14, 20, 26, and 32 ...
http://www.gpcr.org/7tm/seq/all/Q8WML9.SW.html

GPCRDB: 24, Last annotation update) DE Corticotropin releasing factor type 2A receptor. GN CRF2A. OS Tupaia belangeri (Northern tree shrew). ...
http://www.gpcr.org/7tm/seq/all/Q8WMM0.SW.html

GPCRDB: 24, Last annotation update) DE Corticotropin releasing factor type 1 receptor. GN CRF1. OS Tupaia belangeri (Northern tree shrew). ...
http://www.thieme.de/zfg/abstracts2003/daten/3591.html

3591 : Primary tupaia hepatocytes: an alternative to human ...: Susceptibility of the asian tree shrew Tupaia belangeri for the human hepatitis B virus (HBV) has been shown in vivo and in vitro. ...
http://virology.hyg.uni-heidelberg.de/Virology/englisch/forschung/darai/darai.htm

Darai: Hans-Jürgen Scholz: Pathogenität, Latenz und Organtropismus von Herpes simplex Virus in Tupaia belangeri, 1983, magna cum laude. ...
http://biomserv.univ-lyon1.fr/wiki/e2m2theses/moin.cgi/GheitTarik

Universite Claude Bernard LYON1 - Ecole Doctorale E2M2 -: ...- ... anti-VHB. Un autre primate, le Tupaia Belangeri semble être sensible au VHB in vitro en culture primaire et in vivo. Les études ...
http://www.biomedcentral.com/news/20021106/08

The Scientist :: Eberhard Fuchs awarded Stifterverband prize: In a study published last year, adult male tree shrews (Tupaia belangeri) were exposed to four weeks of psychosocial conflict — an experimental model for ...
http://www.receptors.org/NR/seq/all/GCR_TUPGB.SW.html

Swiss-Prot entry: ...receptor and mineralocorticoid receptor RT cDNA and gene expression in the central nervous system of the tree RT shrew (Tupaia belangeri)."; RL Brain Res. Mol. ...
http://www.sanctuaryasia.com/features/detailfeaturescategory.php?id=485&catid=33

Sanctuary Asia - Features: Three species are found in India, two on the mainland (the Madras tree shrew Anathana ellioti and the Northern tree shrew Tupaia belangeri) and one in the ...
http://sege.ntu.edu.sg/cgi-bin/extract_info.pl?dbase=gbmam&field=protein&pop=58&type=1

Your Search Results: SVRSGPFRQIFRPDNFVF{G}QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGF > 54721_AF543566 Tupaia belangeri homeobox PBX2 gene, exons 5 and 6 and partial cds;and SINE ...
http://sege.ntu.edu.sg/cgi-bin/extract_info.pl?dbase=gbmam&field=protein&pop=40&type=1

Your Search Results: 103..630) , product("lipopolysaccharide-binding protein") LLLGSESSGRPTVAVSSCSSHIDDVETHMSGDL{S}WLLNLFHN > 54415_AF278726 Tupaia belangeri sperm membrane protein ...
http://genomebiology.com/pubmed/10591999

Defining the ancestral karyotype of all primates by ...: ...bivariate fluorescence-activated flow sorting of chromosomes from human, black lemur (Eulemur macaco macaco) and tree shrew (Tupaia belangeri, order Scandentia ...
http://animaldiversity.ummz.umich.edu/site/accounts/classification/Tupaia.html

ADW: Tupaia: Classification: ...tree shrews). Species Tupaia belangeri (northern tree shrew). Species Tupaia chrysogaster (golden-bellied tree shrew). Species Tupaia ...
http://www.nmnh.si.edu/msw/mammals_checklist.txt

Monotremata Tachyglossidae Tachyglossus Tachyglossus aculeatus ...: ...soricipes Scandentia Tupaiidae Tupaiinae Anathana Anathana ellioti Dendrogale Dendrogale melanura Dendrogale murina Tupaia Tupaia belangeri Tupaia chrysogaster ...
http://www.ingenta.com/isis/searching/ExpandTOC/ingenta?issue=pubinfobike://els/00426822/2003/00000317/00000002&index=13

Ingenta: Article Summary -- Full-length genome sequence of Mossman ...: MoV appears to be more closely related to another unclassified paramyxovirus Tupaia paramyxovirus (TPMV), isolated from the tree shrew Tupaia belangeri. ...
http://www.uvm.edu/~jdecher/Lecture10.html

Lecture 12 - Mac/Der/Scan.: Holst, Dv 1972. Renal failure as the cause of death in Tupaia belangeri exposed to persistent social stress. Journal of Comparative Physiology, 78:236-273. ...
http://www.signaling-gateway.org/molecule/query?afcsid=A000426&type=blast&adv=latest

[an error occurred while processing this directive] Tupaia belangeri [an error occurred while processing this directive] 41492
Northern Tree Shrew Northern Tree Shrew

Home | Search | About


Copyright SpeciesList.com 2003-2009