|
|
Xiphophorus gordoni - Platy Cuatro CienegasIUCN Status: [an error occurred while processing this directive]IUCN Species Profile http://www.fishbase.org/ListByLetter/ScientificNamesX.htm Scientific Name - Search Result, ALPHABETICAL: Xiphophorus cortezi. Xiphophorus couchianus. Xiphophorus evelynae. Xiphophorus gordoni. Xiphophorus hellerii. Xiphophorus kosszanderi. Xiphophorus maculatus. ... http://www.redlist.org/search/details.php?species=23157 IUCN Red List of Threatened Species - Xiphophorus gordoni: Xiphophorus gordoni. Taxonomy. Kingdom, ANIMALIA. Phylum, CHORDATA. ... Citation: Contreras-Balderas, S. & Almada-Villela, P. 1996. Xiphophorus gordoni. In: IUCN 2003. ... http://www.poeciliascotia.org.uk/xgordoni.htm XIPHOPHORUS GORDONI: XIPHOPHORUS GORDONI. PHOTO CREDIT : DAVE Mac ALLISTER. http://www.poeciliascotia.org.uk/galleryxiphophorus.htm galleryxiphophorus: XIPHOPHORUS CORTEZI. XIPHOPHORUS COUCHIANUS. XIPHOPHORUS EVELYNAE. XIPHOPHORUS GORDONI. XIPHOPHORUS HELLERI. XIPHOPHORUS MACULATUS. XIPHOPHORUS MALINCHE. ... http://www.webcityof.com/miff1099.htm Master Index of Freshwater Fishes (X - Y): Apodaca (Girard 1859, G9:194) [S86167] "Monterrey Platy" `Monterrey-Platy` Xiphophorus couchianus gordoni See Xiphophorus gordoni Xiphophorus evelynae (Rosen ... http://www.webcityof.com/miff1065.htm Master Index of Freshwater Fishes (Nomorhamphus brembachi - O): ...- ... Nördlicher Kärpfling See Cnesterodon septentrionalis Nördlicher Zwergbarsch See Nannoperca ozleyana Nord-Platy See Xiphophorus gordoni Norman's Lampeye See ... http://www.funet.fi/pub/sci/bio/life/pisces/actinopterygii/cyprinodontiformes/poeciloidea/poeciliidae/poeciliinae/xiphophorus/ Xiphophorus: ...as) Xiphophorus gordoni Xiphophorus couchianus gordoni Rosen & Bailey, 1963 Xiphophorus gordoni Miller & Minckley, 1963; (synonym) ... http://www.funet.fi/pub/sci/bio/life/warp/fish-index-g-j.html All (in this database) Fish list (Scientific names): ...gordoni (Xiphophorus); gordoni (Xiphophorus couchianus), see Xiphophorus gordoni; gordon-smithi (Cichlasoma), see Parapetenia trimaculata; ... http://home.clara.net/xenotoca/xiphopho.htm Xiphophorus Genus Fact Sheet: Morphs:- different colours and spots. Xiphophorus gordoni. Quatrocienegas Platy (Northern Platyfish). Status in nature:- Endangered ... http://home.clara.net/xenotoca/kjellpics.htm The following photo: Poecilia sphenops. Scolichtys grenwayi. Xiphophorus cochianus female. Xiphophorus cochianus male. Xiphophorus gordoni. Xiphophorus helleri. Xiphophorus milleri. ... http://hot-server.de/poecilia/xiphomania/xipho.htm xipho: ...andersi Anders Platyfish Xiphophorus couchianus Monterrey Platy (picture) Xiphophorus evelynae Puebia Platy (picture) Xiphophorus gordoni Quatrocienegas Platy ... http://filaman.uni-kiel.de/Country/CountrySpeciesSummary.cfm?Country=Mexico&Genus=Xiphophorus&Species=gordoni filaman.uni-kiel.de/Country/CountrySpeciesSummary.cfm?Country=Mexico&Genus=Xiphophorus&Species=gordoni: Similar pages Length-Frequency Analysis WizardLength-Frequency Analysis Wizard (Xiphophorus gordoni) Step 1: Introduction, FishBase. In the following you will be guided through ... http://filaman.uni-kiel.de/report/LFAnalysis_step01.cfm?speccode=6224 El Acuarista>Atlas>El Género Xiphophorus: ...- ... Xiphophorus evelynae, Xiphophorus variatus evelynae Platy de Puebla. Xiphophorus gordoni, Xiphophorus couchianus gordoni Platy de las Cuatro Ciénagas. ... http://www.akvaunion.dk/fopdr/FOPDR-X.HTM fopdr-X.htm: ...continens Albert Palner 1994 Xiphophorus couchianus **** 6 20 Kaj Mortensen 1985 Xiphophorus evelynae 5 40 Thorkel Steenberg 1985 Xiphophorus gordoni *** 6 20 ... http://www2.biology.ualberta.ca/jackson.hp/IWR/Taxa/Cyprinodontiformes/Poeciliidae/Xiphophorus/index.php IWR: Cyprinodontiformes: Poeciliidae: Xiphophorus: Xiphophorus gordoni Miller & Minckley - Cuatro Ciénegas platyfish / espada de Cuatro Ciénegas - text - photograph - In: TNHC Fishes of North America - Dean ... http://membres.lycos.fr/velifera/especes_menacees.htm Espèces menacées: ...- ... Poecilia heterandria Poecilia vivipara, Skiffia bilineata, Xenotaenia resolanae Xenotoca melanosoma, Xiphophorus andersi, Xiphophorus gordoni et Xiphophorus ... http://www.utexas.edu/ftp/depts/tnhc/.www/fish/dfc/na/poecilii/xiphopho/xgordoni/xgordoni.html www.utexas.edu/ftp/depts/tnhc/.www/fish/dfc/na/poecilii/xiphopho/xgordoni/xgordoni.html: Similar pages PECES EN LA NOM - ... Xiphophorus couchianus, Espada de Monterrey, En peligro de extinción. Xiphophorus gordoni, Espada Cuatrociénegas, En peligro de extinción. ... http://www.conabio.gob.mx/institucion/estrategia_nacional/pecesnom.htm CUATRO CIÉNEGAS: ...- ... Ictalurus lupus, Lepomis megalotis, Lucania interioris, Notropis xanthicara, Poecilia mexicana, Pylodictis olivaris, Xiphophorus gordoni; de reptiles y ... http://servidor.seplade-coahuila.gob.mx/ohs_images/seplade/ice3/recnat/vida%20silvestre/peape.html Vida Silvestre: ...- ... Styodon signifer, Carpa de Parras, P*. Xiphophorus gordoni, Espada cuatrociénegas, P*. Xiphophorus meyeri, Espada de Múzquiz, P*. REPTILES. ... http://www.lebendgebaerende-aquarienfische.de/html/xiphophorus_.html Xiphophorus: ...- ... RR Miller & WL Minckley (1963) : Xiphophorus gordoni, a new species of platyfish from Coahuila, Mexico. ... Xiphophorus gordoni Miller & Minckley, 1963. ... http://www.mn-aquarium.org/spawn92.htm Minnesota Aquarium Society-Breeders Award Program Spawns 1992: Xiphophorus gordoni; Xiphophorus helleri(5); Xiphophorus maculatus(4); Xiphophorus milleri(5); Xiphophorus variatus(3). Page developed by Ted Jolivette. http://perso.wanadoo.fr/denis.vaufrey/aquarium/amcent.htm AMERIQUE CENTRALE: POECILIIDES, XIPHOPHORUS, evelynae (platy), nc, nc, nc. POECILIIDES, XIPHOPHORUS, gordoni (platy), nc, nc, nc. POECILIIDES, XIPHOPHORUS, helleri (xipho), 9. 7,5. 20. ... http://livebearers.org/baprules.html ALA BAP Rules: Ataeniobius toweri Xiphophorus counchianus. Belenesox belizanus Xiphophorus gordoni. Characodon audax any Anableps species. Characodon lateralis any Embiotoid. ... http://www.xiphophorus.org/xiphspecies.htm Index of Xiphophorus Species: ...et al., 1990) Xiphophorus cortezi (Rosen 1960) Xiphophorus couchianus (Girard 1859) Xiphophorus evelynae (Rosen 1960) Xiphophorus gordoni (Miller and Minckley ... http://www39.pair.com/jartigas/juanmi/peces/default.html Juan Miguel Artigas Azas - my hobby: Pseudoxiphophorus bimaculatus; Xiphophorus gordoni; Xiphophorus helleri; Xiphophorus sp. clemenciae. Cyprinodontidae. Cyprinodon atrorus; ... http://www.afae.it/pages/tematica/poecilidi/schedepoecilidi/xipho/tabella_xipho.htm tabella xipho: ...not established Morphs:- different colours and spots. Xiphophorus gordoni. Quatrocienegas Platy (Northern Platyfish) Status in nature ... http://www.afae.it/pages/tematica/poecilidi/poecilidi.htm POECILIDI: ...- ... 22. Xiphophorus, evelynae, Mexico, 4 - 5,5, Semi - Comunità , 10 - 22. Xiphophorus, gordoni, Mexico, 2,5 - 4, Specifica, 30 - 32. Xiphophorus, ... http://www.edizioniprimaris.com/analitico/02tetram_z.htm 2002.htm: ìarancioî 02/5 - 17 Xiphophorus cortezi 02/9 - 23 Xiphophorus couchianus 02/5 - 18, 02/5 - 19** Xiphophorus evelynae 02/5 - 19** Xiphophorus gordoni 02/5 - 19 ... http://www.ecoah.org/recnat/vida%20silvestre/aves/peape.html Vida Silvestre: ...- ... Styodon signifer, Carpa de Parras, P*. Xiphophorus gordoni, Espada Cuatro Ciénegas, P*. Xiphophorus meyeri, Espada de Múzquiz, P*. REPTILES. ... http://www.ecoah.org/recnat/Planeacion/sibic/Fausierryllanoscahuilenses.html Planeacion: ...- ... Gambusia, speciosa, Guayacon del oeste, X. //. /. /. /..... P. Xiphophorus, gordoni*, Espada de Cuatrocienegas, X. /. /. /. /. /.... P. Xhiphophorus, ... http://www.biosis.org.uk/ion/results.asp?seek=Xiphophorus%20gordoni Search results: Index To Organism Names: Search Results. Request Details. Searching for : Xiphophorus gordoni. Search Results. No results found. Search again. ... http://www.backflip.com/members/wazzup/10019754/sort=0/ Backflip Publisher: wazzup | Folder: Platys o. svärdbärare: Xiphophorus gordoni images Xiphophorus gordoni Cuatro Ciénegas platyfish (added 2001/08/17) Platys o. svärdbärare > http://www.desertfishes.org/na/poecilii ... http://www.akvarium.cz/1899/kpdz/system/poeciliidae/poeciliidae.htm Systém: Morizot, 1990) n Xiphophorus cortezi (Rosen, 1960) n Xiphophorus couchianus (Girard, 1859) n Xiphophorus evelynae (Rosen, 1960) n Xiphophorus gordoni (Miller & ... http://www.fishbase.org.ph/Reproduction/FishReproSummary.cfm?GenusName=Xiphophorus&SpeciesName=gordoni&stockcode=6537 Reproduction Summary: Reproduction of Xiphophorus gordoni. Main Ref: Wischnath, L., 1993. Mode: dioecism. Fertilization: internal (oviduct). Spawning frequency: Batch spawner: Ref. ... http://www.fishbase.org.ph/xml/comnamesxml.cfm?genus=Xiphophorus&species=gordoni&type= Successful connection, 4 record(s) found. Xiphophorus gordoni 6224 ...: Xiphophorus gordoni 6224 Nord-Platy Germany German Vernacular Northern platyfish USA English AFS Platy Cuatro Cienegas UK English Vernacular Platy Cuatro ... http://www.panda.org/about_wwf/where_we_work/ecoregions/global200/pages/regions/region194.htm WWF - Global 200: Three endangered endemic fishes are Cuatro Ciénegas shiner (Notropis xanthicara), Cuatro Ciénegas darter (Xiphophorus gordoni), and sardinilla (Lucania ... http://www.livingfish.co.uk/forum/more_to_platies.asp Viviparous Forum: ...again. The two other platy species also on the brink are the Quatrocienegas platy, Xiphophorus gordoni, and the Muzquiz platy. Both ... http://www.specola.unifi.it/EVAidc/RedList.idc?class=&order=&family=&status=1 EVA - List -: ACTINOPTERYGII, Cyprinodontiformes, Poeciliidae, Xiphophorus gordoni, ACTINOPTERYGII, Cyprinodontiformes, Poeciliidae, Xiphophorus meyeri, ... http://cafe.pti.ru/st/96b3/terehin/fam_ga.html СемейÑ?тво Гамбузиевые (Poeciliidae): Ð’ КраÑ?ную книгу МСОП занеÑ?ены: Gambusia amistadensis, G. gaigei, G. heterochir, G. longispinnis, G. nobilis, Xiphophorus gordoni. Ð¥. ... http://biodiversity.uno.edu/.mexico/specieslist.html WORKING LIST OF THE NATIVE FRESHWATER FISHES OF MEXICO: Monterrey Platyfish. [E]; Xiphophorus evelynae Rosen; Xiphophorus gordoni Miller & Minckley. Cuatro Cienégas Platyfish. [E]; Xiphophorus helleri Heckel. ... http://64.95.130.5/fishwatcher/url_addform.cfm?speccode=6224 Show all attached URLs: Show all attached URLs. Add URL for Xiphophorus gordoni, FishBase. URL: (eg www.mytank/myboxfish.htm) Note: please use URL for this ... http://sege.ntu.edu.sg/cgi-bin/extract_info.pl?dbase=gbvrt&field=protein&pop=102&type=1 Your Search Results: KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEFMDQ{G}SLLEFLKGQYSTMLRLPQLVDFASQ{I}ASG MAYVERMNYVHRDLRAANILVGDNLVC > 44350_XGU06605 Xiphophorus gordoni isolate XG ... http://www.cichlidae.com/talks/c022.php The Cichlid Room Companion - The Cichlid from the desert ...: ...lagoons. There you also find Xiphophorus gordoni, A fish with its origin in rivers were Herichthys cyanoguttatus inhabits. JuanMi ... http://www.aquaria.ru/cgi/aart/a.cgi?index=989 Ð?квариум - наука или развлечение? ...: Priapella bonita. Xiphophorus clemenciae. Xiphophorus couchianus. Xiphophorus gordoni. Xiphophorus meyeri. СемейÑ?тво Goodeidae. Ameca splendens. ... http://ichtyonb1.mnhn.fr/Photos/ThumbnailsSummary.cfm?ID=6224 tn_Xigor_u0.jpg: Pictures available for Xiphophorus gordoni. Google Images (Click on picture to enlarge and see data), FishBase. tn_Xigor_u0.jpg picture ... http://taxon.molgen.mpg.de/gettaxon?taxid=8079 TAXON Query Form: 32474, info); species: Xiphophorus gordoni (TaxID 32475, info); species: Xiphophorus malinche (TaxID 32476, info); species: Xiphophorus ... http://aquadb.nrifs.affrc.go.jp/~aquadb/cgi-bin/tax_hl.cgi?TTAXID=8084 Tax Data: ...species(種), Xiphophorus evelynae, ddbj information. species(種), Xiphophorus gordoni, ddbj information. species(種), Xiphophorus malinche, ddbj information. ... http://people.clemson.edu/~jwfoltz/wfb418/subjects/cienegas/cienegas.htm Cuatro Ciénegas "Four Marshes" of Mexico: ...implemented. Cuatro Ciénegas platyfish Xiphophorus gordoni. FAMILY POECILIIDAE - livebearers. Distribution and Abundance. Restricted ... http://bighost.area.ba.cnr.it/srs6bin/wgetz?-e+%5BTAXONOMY:'32475'%5D TAXONOMY:32475 ID : 32475 PARENT ID : 8082 RANK : species GC ID ...: TAXONOMY:32475 ID : 32475 PARENT ID : 8082 RANK : species GC ID : 1 MGC ID : 2 SCIENTIFIC NAME : Xiphophorus gordoni // http://www.peter.unmack.net/acn/as/4/vol4no3.html Aquatic Survival, Volume 4, Number 3 - September 1995: ...longidorsalis Cyprinodon veronicae Lucania interioris Megupsilon aporus Gambusia longispinis Xiphophorus couchianus Xiphophorus gordoni Xiphophorus meyeri ... http://www.peter.unmack.net/acn/as/1/vol1no3.txt [an error occurred while processing this directive] Xiphophorus gordoni [an error occurred while processing this directive] 23157 Platy Cuatro Cienegas Platy Cuatro Cienegas Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |